You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable copper-transporting ATPase
Synonyms
  • Cu(2+)-ATPase
Gene NamePCA1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionProbably involved in copper transport and in the regulation of cellular copper level
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00207Copper(2+)Show
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
integral to membrane
cell part
membrane
membrane part
intrinsic to membrane
Function
purine nucleoside binding
hydrolase activity
adenyl nucleotide binding
substrate-specific transmembrane transporter activity
metal ion transmembrane transporter activity
adenyl ribonucleotide binding
ion transmembrane transporter activity
cation transmembrane transporter activity
ATP binding
inorganic cation transmembrane transporter activity
ion binding
ATPase activity, coupled to transmembrane movement of ions
catalytic activity
di-, tri-valent inorganic cation transmembrane transporter activity
cation binding
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
copper ion transmembrane transporter activity
metal ion binding
hydrolase activity, acting on acid anhydrides
copper-transporting ATPase activity
transporter activity
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
copper-exporting ATPase activity
transmembrane transporter activity
binding
nucleoside binding
Process
purine ribonucleoside triphosphate biosynthetic process
ATP biosynthetic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
ion transport
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
metabolic process
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
cation transport
metal ion transport
establishment of localization
purine nucleoside triphosphate biosynthetic process
transport
Gene Properties
Chromosome Locationchromosome 2
LocusYBR295W
Gene Sequence>3651 bp ATGAAGCCGGAAAAACTCTTCTCCGGTTTAGGTACCAGCGATGGCGAGTATGGAGTGGTA AATAGCGAGAACATATCAATAGATGCTATGCAAGATAATAGAGGCGAGTGTCATCGTAGA TCCATAGAAATGCATGCTAATGACAATCTGGGATTGGTCTCCCAGCGAGACTGTACCAAT CGGCCCAAAATTACTCCTCAGGAATGTTTGAGTGAGACTGAGCAGATATGCCATCATGGC GAGAATAGGACTAAGGCTGGGTTAGATGTAGACGATGCTGAAACCGGTGGTGATCACACC AATGAATCCCGTGTAGATGAATGTTGTGCTGAGAAAGTGAACGACACTGAGACTGGCTTG GATGTGGACAGCTGTTGCGGCGATGCTCAAACAGGTGGTGACCACACCAATGAATCCTGT GTTGATGGATGCTGCGTTAGAGATTCTTCAGTGATGGTCGAGGAAGTTACAGGCAGCTGC GAAGCTGTATCTTCTAAAGAACAATTGCTGACCAGCTTTGAAGTTGTTCCAAGCAAATCT GAAGGTCTGCAATCTATTCATGATATTAGAGAGACAACTCGCTGCAATACCAATTCCAAC CAACACACAGGGAAGGGTAGGCTTTGCATCGAATCAAGTGACTCTACACTCAAGAAAAGA AGTTGTAAAGTTAGCAGACAGAAAATTGAGGTTTCCAGTAAGCCTGAGTGCTGCAACATT TCATGTGTTGAGCGGATTGCATCTCGTAGCTGTGAAAAGAGGACTTTTAAAGGTAGCACC AATGTTGGAATTTCTGGGAGTAGCTCTACCGACAGTTTAAGCGAGAAGTTCTTCAGCGAA CAGTACTCTAGAATGTACAATCGTTACTCCTCAATTTTGAAAAATTTAGGTTGTATCTGT AACTATTTGCGTACTTTGGGAAAAGAATCTTGTTGTCTCCCAAAGGTGCGTTTTTGTAGC GGGGAGGGTGCTTCTAAAAAGACAAAATACTCCTACCGCAACAGTTCTGGATGTTTAACA AAGAAAAAGACCCATGGAGACAAAGAAAGGTTGAGCAATGACAATGGCCATGCTGATTTT GTTTGTTCTAAAAGTTGTTGCACTAAAATGAAGGATTGTGCTGTTACCTCAACTATTTCT GGAACCTCTTCGAGTGAAATTTCAAGAATCGTATCAATGGAACCAATTGAAAATCATCTT AATCTTGAGGCAGGATCTACCGGTACCGAGCACATTGTTCTTAGTGTTTCAGGAATGTCC TGTACTGGTTGTGAATCAAAACTTAAGAAATCATTTGGCGCGCTCAAATGTGTTCACGGT TTGAAGACCAGTTTAATATTATCGCAAGCTGAATTTAATCTGGATCTTGCTCAGGGATCT GTCAAGGATGTTATCAAGCACTTGAGCAAAACTACTGAATTCAAGTACGAACAGATTTCA AATCATGGTTCAACTATAGATGTTGTTGTTCCTTATGCAGCAAAAGATTTTATTAATGAG GAATGGCCACAAGGTGTCACAGAGCTGAAAATTGTTGAGAGAAATATCATTCGTATTTAC TTTGACCCAAAGGTTATAGGTGCCAGAGATCTTGTCAATGAAGGATGGAGCGTGCCTGTT AGTATTGCTCCATTCAGTTGTCATCCAACCATTGAAGTGGGAAGGAAGCATTTAGTTCGT GTAGGCTGCACGACCGCTTTATCCATAATATTGACGATCCCGATTCTCGTGATGGCTTGG GCTCCACAGCTTCGTGAAAAAATTTCCACTATCTCCGCGTCAATGGTGCTAGCAACTATT ATTCAATTTGTTATTGCAGGACCGTTTTACTTAAATGCCTTGAAGAGTTTGATATTTTCC AGGCTCATTGAAATGGATCTACTAATAGTTTTAAGCACTAGCGCTGCCTACATATTTTCG ATTGTATCATTTGGATATTTCGTTGTTGGACGCCCGTTATCTACGGAGCAGTTTTTTGAA ACCAGCTCTTTGCTTGTAACTCTCATCATGGTTGGTCGCTTTGTGAGTGAACTAGCTAGA CATAGGGCTGTAAAGTCAATATCAGTACGTTCCTTACAGGCCTCTTCTGCTATTCTGGTG GATAAAACTGGTAAAGAGACGGAAATTAATATTAGACTTCTCCAATATGGCGATATTTTT AAGGTTTTACCTGATTCAAGAATCCCAACTGATGGAACAGTCATTTCTGGGTCTTCTGAA GTCGACGAAGCGTTAATCACAGGTGAATCTATGCCAGTCCCGAAAAAGTGTCAATCAATT GTTGTTGCAGGATCGGTGAATGGCACTGGTACTTTGTTTGTGAAGCTGAGCAAGCTTCCA GGGAACAATACTATTAGTACCATAGCCACGATGGTTGATGAAGCAAAATTAACTAAGCCA AAGATCCAAAATATCGCTGATAAAATTGCAAGTTATTTCGTGCCAACTATCATTGGAATC ACTGTCGTCACCTTTTGCGTTTGGATAGCGGTTGGAATCCGTGTGGAAAAGCAATCCCGC TCCGATGCCGTAATTCAGGCCATTATATATGCCATTACGGTACTTATCGTTTCGTGTCCC TGCGTGATTGGACTTGCCGTTCCTATCGTATTTGTTATTGCAAGTGGCGTCGCTGCGAAA AGAGGGGTAATCTTCAAATCAGCAGAGAGTATAGAAGTTGCTCACAACACTTCGCATGTT GTCTTCGATAAAACGGGTACCCTAACTGAAGGAAAACTTACTGTAGTACATGAAACTGTT AGGGGTGATCGTCATAATTCTCAATCTTTGTTGCTTGGATTAACTGAAGGAATAAAACAC CCAGTTTCCATGGCAATAGCATCCTATCTCAAAGAAAAAGGTGTTTCTGCTCAAAATGTT TCTAATACAAAAGCTGTGACTGGTAAGCGGGTAGAAGGAACATCATACTCTGGTTTGAAG TTACAAGGAGGGAACTGTCGTTGGCTTGGTCATAACAATGATCCTGACGTTCGAAAAGCC CTTGAACAAGGATATTCTGTATTCTGTTTTAGTGTTAATGGTTCAGTCACTGCAGTTTAT GCATTAGAGGACTCTTTACGGGCAGATGCTGTCTCCACTATTAACTTGTTACGCCAAAGA GGGATTTCACTACACATTTTATCAGGGGATGACGATGGAGCCGTTCGTTCTATGGCAGCC CGTCTTGGAATTGAAAGCTCCAATATTCGTTCTCACGCAACGCCTGCAGAAAAGAGTGAA TATATTAAGGATATTGTCGAAGGAAGAAATTGCGATAGTTCTTCGCAGTCAAAAAGACCG GTTGTTGTTTTTTGCGGTGACGGAACAAACGACGCAATTGGTTTGACTCAAGCAACGATT GGAGTTCATATCAATGAGGGAAGTGAGGTTGCCAAGCTAGCTGCTGATGTAGTTATGTTA AAGCCAAAGCTCAACAATATTTTGACTATGATAACTGTAAGTCAAAAGGCCATGTTTAGG GTCAAATTGAATTTCTTATGGAGTTTTACTTACAACTTATTTGCTATCCTTTTGGCGGCT GGTGCCTTTGTTGACTTTCATATTCCACCAGAGTATGCGGGTTTAGGGGAACTAGTTAGT ATCCTCCCTGTAATTTTTGTAGCTATACTTCTGCGTTATGCAAAGATTTAG
Protein Properties
Pfam Domain Function
Protein Residues1216
Protein Molecular Weight131838.0
Protein Theoretical pI7.54
Signalling Regions
  • None
Transmembrane Regions
  • 557-578
  • 593-612
  • 621-641
  • 660-680
  • 809-831
  • 848-865
  • 1162-1181
  • 1191-1209
Protein Sequence>Probable copper-transporting ATPase MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNLGLVSQRDCTN RPKITPQECLSETEQICHHGENRTKAGLDVDDAETGGDHTNESRVDECCAEKVNDTETGL DVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVSSKEQLLTSFEVVPSKS EGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSDSTLKKRSCKVSRQKIEVSSKPECCNI SCVERIASRSCEKRTFKGSTNVGISGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCIC NYLRTLGKESCCLPKVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADF VCSKSCCTKMKDCAVTSTISGTSSSEISRIVSMEPIENHLNLEAGSTGTEHIVLSVSGMS CTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDVIKHLSKTTEFKYEQIS NHGSTIDVVVPYAAKDFINEEWPQGVTELKIVERNIIRIYFDPKVIGARDLVNEGWSVPV SIAPFSCHPTIEVGRKHLVRVGCTTALSIILTIPILVMAWAPQLREKISTISASMVLATI IQFVIAGPFYLNALKSLIFSRLIEMDLLIVLSTSAAYIFSIVSFGYFVVGRPLSTEQFFE TSSLLVTLIMVGRFVSELARHRAVKSISVRSLQASSAILVDKTGKETEINIRLLQYGDIF KVLPDSRIPTDGTVISGSSEVDEALITGESMPVPKKCQSIVVAGSVNGTGTLFVKLSKLP GNNTISTIATMVDEAKLTKPKIQNIADKIASYFVPTIIGITVVTFCVWIAVGIRVEKQSR SDAVIQAIIYAITVLIVSCPCVIGLAVPIVFVIASGVAAKRGVIFKSAESIEVAHNTSHV VFDKTGTLTEGKLTVVHETVRGDRHNSQSLLLGLTEGIKHPVSMAIASYLKEKGVSAQNV SNTKAVTGKRVEGTSYSGLKLQGGNCRWLGHNNDPDVRKALEQGYSVFCFSVNGSVTAVY ALEDSLRADAVSTINLLRQRGISLHILSGDDDGAVRSMAARLGIESSNIRSHATPAEKSE YIKDIVEGRNCDSSSQSKRPVVVFCGDGTNDAIGLTQATIGVHINEGSEVAKLAADVVML KPKLNNILTMITVSQKAMFRVKLNFLWSFTYNLFAILLAAGAFVDFHIPPEYAGLGELVS ILPVIFVAILLRYAKI
References
External Links
ResourceLink
Saccharomyces Genome Database PCA1
Uniprot IDP38360
Uniprot NameATU1_YEAST
GenBank Gene IDZ29332
Genebank Protein ID547580
General Reference
  • Adle, D. J., Sinani, D., Kim, H., Lee, J. (2007). "A cadmium-transporting P1B-type ATPase in yeast Saccharomyces cerevisiae." J Biol Chem 282:947-955.17107946
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Rad, M. R., Kirchrath, L., Hollenberg, C. P. (1994). "A putative P-type Cu(2+)-transporting ATPase gene on chromosome II of Saccharomyces cerevisiae." Yeast 10:1217-1225.7754711
  • Shiraishi, E., Inouhe, M., Joho, M., Tohoyama, H. (2000). "The cadmium-resistant gene, CAD2, which is a mutated putative copper-transporter gene (PCA1), controls the intracellular cadmium-level in the yeast S. cerevisiae." Curr Genet 37:79-86.10743563