You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSulfate permease 1
Synonyms
  • High-affinity sulfate transporter 1
Gene NameSUL1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in secondary active sulfate transmembrane transporter activity
Specific FunctionHigh affinity uptake of sulfate into the cell
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00005SulfateShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
anion transmembrane transporter activity
inorganic anion transmembrane transporter activity
sulfate transmembrane transporter activity
secondary active sulfate transmembrane transporter activity
transporter activity
transmembrane transporter activity
Process
inorganic anion transport
establishment of localization
sulfate transport
transport
ion transport
anion transport
transmembrane transport
Gene Properties
Chromosome Locationchromosome 2
LocusYBR294W
Gene Sequence>2580 bp ATGTCACGTAAGAGCTCGACTGAATATGTGCATAATCAGGAGGATGCTGATATCGAAGTA TTTGAATCAGAATACCGCACATATAGGGAATCTGAGGCGGCAGAAAACAGAGACGGACTT CACAATGGTGATGAGGAAAATTGGAAGGTTAATAGTAGTAAGCAGAAATTTGGGGTAACG AAAAATGAGCTATCAGATGTCCTGTACGATTCCATTCCAGCGTATGAAGAGAGCACAGTC ACTTTGAAGGAGTACTATGATCATTCTATCAAAAACAATCTAACTGCGAAATCGGCAGGA AGTTACCTCGTATCTCTTTTTCCTATTATAAAATGGTTTCCTCATTATAACTTTACGTGG GGCTATGCTGATTTAGTGGCAGGAATTACAGTTGGCTGCGTACTCGTGCCCCAATCTATG TCATACGCACAAATCGCTAGTTTATCTCCTGAATATGGTTTGTATTCCTCCTTTATTGGT GCGTTTATATATTCTTTGTTTGCCACATCGAAAGATGTTTGTATTGGTCCGGTCGCTGTA ATGTCACTACAAACTGCCAAAGTCATTGCTGAAGTTCTAAAAAAATATCCCGAAGACCAG ACAGAAGTTACAGCTCCTATCATTGCAACTACCCTTTGTTTGCTTTGTGGGATTGTCGCC ACTGGGTTGGGTATACTGCGTTTAGGCTTTTTAGTGGAACTTATTTCTCTAAATGCTGTT GCTGGCTTCATGACCGGTTCCGCATTTAACATCATCTGGGGTCAAATTCCGGCTCTCATG GGATACAACTCATTAGTGAATACCAGAGAAGCAACGTATAAGGTTGTAATTAACACTCTG AAACATTTACCAAACACAAAGTTAGACGCCGTTTTTGGCTTGATTCCGTTGGTAATCCTC TATGTATGGAAATGGTGGTGTGGTACATTTGGTATAACTTTGGCAGATAGATATTATCGA AATCAACCAAAGGTAGCGAATAGACTGAAATCCTTCTATTTCTATGCACAAGCTATGAGA AATGCCGTCGTCATAGTAGTTTTTACTGCCATATCGTGGAGCATAACAAGAAACAAATCT TCAAAAGACCGTCCAATCAGTATTCTGGGTACAGTTCCCTCGGGCTTAAATGAGGTGGGA GTTATGAAAATCCCAGACGGTCTGCTATCTAATATGAGTTCAGAAATACCTGCTTCAATT ATCGTTCTGGTGTTAGAACACATCGCTATTTCAAAATCCTTTGGTAGAATTAACGACTAC AAGGTTGTCCCTGACCAAGAACTTATTGCGATTGGTGTGACAAATTTGATAGGGACATTT TTTCACTCATATCCAGCAACTGGGTCATTTTCCAGATCTGCTTTGAAGGCAAAATGTAAC GTGCGCACTCCGTTTTCTGGGGTATTCACTGGCGGTTGCGTTCTATTAGCACTTTATTGT TTAACTGACGCCTTCTTTTTCATTCCTAAAGCGACACTATCGGCGGTTATTATTCATGCT GTTTCTGATTTGCTGACTTCTTACAAAACCACCTGGACCTTCTGGAAGACCAACCCGTTA GATTGTATCTCATTTATCGTTACAGTGTTCATCACAGTATTTTCATCCATTGAAAATGGT ATATATTTTGCAATGTGTTGGTCATGTGCAATGTTACTATTGAAACAGGCTTTCCCTGCT GGTAAATTCCTTGGTCGTGTTGAGGTGGCAGAAGTATTGAACCCAACAGTACAAGAGGAT ATTGATGCTGTGATATCATCTAATGAATTACCTAATGAACTGAATAAACAGGTTAAGTCT ACTGTTGAGGTTTTACCAGCCCCAGAGTATAAGTTTAGCGTAAAGTGGGTTCCGTTCGAT CATGGATACTCAAGAGAATTGAATATCAATACCACAGTTCGGCCTCCTCCACCAGGTGTC ATAGTCTATCGTTTGGGTGATAGCTTTACTTACGTGAACTGCTCAAGGCATTATGACATT ATATTTGATCGTATTAAGGAAGAAACAAGGCGAGGCCAACTTATAACCTTAAGGAAAAAG TCAGACCGTCCATGGAATGATCCTGGTGAATGGAAAATGCCAGATTCTTTGAAATCACTA TTTAAATTTAAACGTCATTCAGCAACAACGAATAGTGACCTACCGATATCGAATGGAAGC AGTAACGGAGAAACATATGAAAAGCCGCTACTGAAAGTCGTCTGCCTGGATTTTTCCCAA GTTGCTCAAGTGGATTCAACCGCTGTTCAAAGCCTGGTTGATCTGAGAAAAGCTGTGAAT AGGTATGCGGATAGACAAGTCGAATTCCATTTTGCCGGAATTATATCTCCATGGATCAAA AGAAGTCTTTTGAGTGTTAAATTCGGAACTACAAATGAGGAATATAGTGACGACTCTATT ATCGCTGGCCATTCTAGTTTTCACGTTGCAAAAGTTTTGAAGGATGATGTGGATTATACT GATGAAGACAGCCGTATAAGCACATCTTACAGTAACTATGAAACATTATGTGCTGCAACT GGGACAAATTTACCGTTTTTTCATATCGATATACCCGATTTTTCTAAATGGGACGTTTAG
Protein Properties
Pfam Domain Function
Protein Residues859
Protein Molecular Weight95950.0
Protein Theoretical pI6.78
Signalling Regions
  • None
Transmembrane Regions
  • 94-114
  • 116-136
  • 148-168
  • 173-193
  • 206-226
  • 234-254
  • 292-312
  • 332-352
  • 395-415
  • 428-448
  • 468-488
  • 525-545
Protein Sequence>Sulfate permease 1 MSRKSSTEYVHNQEDADIEVFESEYRTYRESEAAENRDGLHNGDEENWKVNSSKQKFGVT KNELSDVLYDSIPAYEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWFPHYNFTW GYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAV MSLQTAKVIAEVLKKYPEDQTEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISLNAV AGFMTGSAFNIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVIL YVWKWWCGTFGITLADRYYRNQPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSITRNKS SKDRPISILGTVPSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFGRINDY KVVPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYC LTDAFFFIPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENG IYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEDIDAVISSNELPNELNKQVKS TVEVLPAPEYKFSVKWVPFDHGYSRELNINTTVRPPPPGVIVYRLGDSFTYVNCSRHYDI IFDRIKEETRRGQLITLRKKSDRPWNDPGEWKMPDSLKSLFKFKRHSATTNSDLPISNGS SNGETYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNRYADRQVEFHFAGIISPWIK RSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYTDEDSRISTSYSNYETLCAAT GTNLPFFHIDIPDFSKWDV
References
External Links
ResourceLink
Saccharomyces Genome Database SUL1
Uniprot IDP38359
Uniprot NameSUL1_YEAST
GenBank Gene IDAY693178
Genebank Protein ID51013807
General Reference
  • Smith, F. W., Hawkesford, M. J., Prosser, I. M., Clarkson, D. T. (1995). "Isolation of a cDNA from Saccharomyces cerevisiae that encodes a high affinity sulphate transporter at the plasma membrane." Mol Gen Genet 247:709-715.7616962
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Jin, Y. H., Jang, Y. K., Kim, M. J., Rad, M. R., Kirchrath, L., Seong, R. H., Hong, S. H., Hollenberg, C. P., Park, S. D. (1995). "Characterization of SFP2, a putative sulfate permease gene of Saccharomyces cerevisiae." Biochem Biophys Res Commun 214:709-715.7677785
  • Cherest, H., Davidian, J. C., Thomas, D., Benes, V., Ansorge, W., Surdin-Kerjan, Y. (1997). "Molecular characterization of two high affinity sulfate transporters in Saccharomyces cerevisiae." Genetics 145:627-635.9055073