You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlkaline ceramidase YPC1
SynonymsNot Available
Gene NameYPC1
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
Specific FunctionHydrolyzes phytoceramide and also dihydroceramide into phytosphingosine or dihydrosphingosine. Prefers phytoceramide. Has also reverse hydrolysis activity, catalyzing synthesis of phytoceramide and dihydroceramide from palmitic acid and phytosphingosine or dihydrosphingosine. Is not responsible for the breakdown of unsaturated ceramide
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Phytosphingosine + Tetracosanoyl-CoA N-Tetracosanoylphytosphingosine + hydron + Coenzyme A
Phytosphingosine + hexacosanoyl-CoAN-Hexacosanoylphytosphingosine + hydron + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00285PhytosphingosineShow
YMDB00537hexacosanoyl-CoAShow
YMDB00862hydronShow
YMDB00909Tetracosanoyl-CoA Show
YMDB00963N-TetracosanoylphytosphingosineShow
YMDB00964N-HexacosanoylphytosphingosineShow
GO Classification
Component
membrane part
intrinsic to membrane
integral to membrane
cell part
Function
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
catalytic activity
Process
sphingoid metabolic process
ceramide metabolic process
primary metabolic process
lipid metabolic process
cellular lipid metabolic process
metabolic process
membrane lipid metabolic process
sphingolipid metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR183W
Gene Sequence>951 bp ATGGGAATATTTCGTTGGAACTATCCAGAGAGTTCTGTCCCCGGCGTTTGGGGAGAAACA ACTTCCACTATTGACTGGTGTGAGGAGAACTATGTCGTTTCTCCCTATATTGCCGAGTGG TCAAACACTTTAACTAACAGCGTATTCATACTGTCAGCGATTTACACAACTTACTCTGCT TACAAGAATAAATTAGAAAAAAGGTTTTTACTTATTGGCTTCGGGTACGGTTTGGTCGGA GTAGGATCATGGCTATTTCATATGACACTGAAGTATAGATTCCAACTATTGGATGAACTT CCAATGATATACGCCATGTGCATTCCGACATGGAGTTTAGTATGCGAGGCCAAAGAGGCA TTACTTAACGGAGATAATCACAAGAAGGTTCCTCTATTTGAACAGATATTCATCGGCGTA ATTATCGGCCTGGCCGTTACAACAGCAAGCATACTCTACGTTATTTACAAAAATGTCGAT ATCCATCAAATTTTGTTTGGCGTACAGATTGTAGTTGTGGCTGCTACTGCAGGAAGTTTG ACGTACAGATACGTCCATGATCCACTTGCCAAAAGAAATCTCAAGGCTTCAATGGCGCTC GGCGCAATTTTGTTCTTATCTGGCTACATTTCGTGGCTACTTGATATACACTATTGTTCG TTCTGGGTGCACGTTAGAAGAAGTATTTTGGCTTTACCACTTGGTGTACTGCTTGAACCA CACGGATGGTGGCATATATTAACTGGTATGGGGATTTATTTCTACATTGTTTCTTTGGAA CATTTAAGGGTCATTACGCTCAACGTCAGCTGCAATTACCAGTTCATCTGGAGATGGAAA GTCTTCCCTGAACTGATATGGAAAGGGCGCAAACCCTCAACAAGATATTCACTTGAACTA TTTGGCCCATACGTAGAAGATCAATCAATTGAAGTTAAAAAGGAGAAGTAA
Protein Properties
Pfam Domain Function
Protein Residues316
Protein Molecular Weight36419.39844
Protein Theoretical pI8.41
Signalling Regions
  • None
Transmembrane Regions
  • 69-89
  • 94-114
  • 136-156
  • 161-181
  • 196-216
  • 229-249
Protein Sequence>Alkaline ceramidase YPC1 MGIFRWNYPESSVPGVWGETTSTIDWCEENYVVSPYIAEWSNTLTNSVFILSAIYTTYSA YKNKLEKRFLLIGFGYGLVGVGSWLFHMTLKYRFQLLDELPMIYAMCIPTWSLVCEAKEA LLNGDNHKKVPLFEQIFIGVIIGLAVTTASILYVIYKNVDIHQILFGVQIVVVAATAGSL TYRYVHDPLAKRNLKASMALGAILFLSGYISWLLDIHYCSFWVHVRRSILALPLGVLLEP HGWWHILTGMGIYFYIVSLEHLRVITLNVSCNYQFIWRWKVFPELIWKGRKPSTRYSLEL FGPYVEDQSIEVKKEK
References
External Links
ResourceLink
Saccharomyces Genome Database YPC1
Uniprot IDP38298
Uniprot NameYPC1_YEAST
GenBank Gene IDAF191745
Genebank Protein ID7248652
General Reference
  • Mao, C., Xu, R., Bielawska, A., Obeid, L. M. (2000). "Cloning of an alkaline ceramidase from Saccharomyces cerevisiae. An enzyme with reverse (CoA-independent) ceramide synthase activity." J Biol Chem 275:6876-6884.10702247
  • Demolis, N., Mallet, L., Jacquet, M. (1994). "A 12.5 kb fragment of the yeast chromosome II contains two adjacent genes encoding ribosomal proteins and six putative new genes, one of which encodes a putative transcriptional factor." Yeast 10:1511-1525.7871891
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258