You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMedium-chain fatty acid ethyl ester synthase/esterase 2
Synonyms
  • Alcohol O-acetyltransferase
  • Ethanol hexanoyl transferase 1
Gene NameEHT1
Enzyme Class
Biological Properties
General FunctionInvolved in carboxylesterase activity
Specific FunctionDisplays enzymatic activity both for medium-chain fatty acid (MCFA) ethyl ester synthesis and hydrolysis (esterase activity). MCFA are toxic for yeast and this enzyme could thus be involved in their detoxification by esterification
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00312Acetyl-CoAShow
YMDB00570isoamylolShow
YMDB00571isoamyl acetateShow
YMDB00790Isopentyl acetateShow
YMDB00798IsopentanolShow
GO Classification
Component
Not Available
Function
carboxylesterase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
Process
Not Available
Gene Properties
Chromosome Locationchromosome 2
LocusYBR177C
Gene Sequence>1356 bp ATGTCAGAAGTTTCCAAATGGCCAGCAATCAACCCATTCCATTGGGGATACAATGGTACA GTTTCGCATATTGTCGGTGAAAATGGTTCCATTAAACTCCATTTAAAAGACAACAAGGAG CAAGTTGATTTTGACGAGTTCGCTAACAAATATGTCCCAACGTTGAAGAATGGTGCCCAA TTCAAATTGAGTCCTTACTTGTTCACAGGTATTTTGCAAACTTTGTACTTAGGTGCTGCT GATTTCTCTAAGAAATTTCCTGTATTCTACGGCAGGGAAATTGTCAAATTCTCGGATGGT GGAGTTTGCACCGCTGACTGGCTCATAGATTCATGGAAAAAGGATTATGAATTCGATCAA AGTACTACGAGCTTTGATAAAAAAAAATTTGATAAAGACGAGAAGGCGACACATCCAGAA GGATGGCCTCGTTTACAACCACGTACAAGGTACCTGAAAGATAATGAGTTGGAAGAACTA CGGGAGGTTGATCTACCCCTAGTAGTTATTCTACATGGTCTTGCTGGTGGTAGTCATGAG CCGATTATAAGATCTCTTGCTGAAAACCTGTCTCGCAGTGGGAGATTTCAAGTGGTCGTC CTAAATACCAGAGGTTGTGCACGTTCCAAAATTACCACCAGAAATTTATTTACAGCTTAT CACACAATGGATATTCGCGAGTTTTTGCAAAGAGAAAAGCAAAGACATCCAGATAGAAAA CTATACGCTGTGGGATGCTCTTTTGGTGCTACGATGCTGGCAAACTATCTGGGAGAAGAG GGCGATAAATCACCTTTATCCGCAGCTGCTACTTTGTGCAATCCTTGGGATCTTCTCCTT TCAGCAATTAGGATGAGCCAGGATTGGTGGTCAAGAACTTTATTTTCCAAAAATATTGCG CAATTCTTAACAAGAACCGTTCAGGTTAATATGGGTGAATTAGGAGTTCCAAATGGCTCT CTCCCCGATCATCCTCCCACAGTCAAGAATCCATCTTTCTATATGTTCACGCCTGAAAAT CTAATAAAGGCAAAGAGCTTTAAATCGACCCGGGAATTTGATGAAGTGTACACTGCGCCT GCTTTAGGCTTCCCAAATGCTATGGAGTATTATAAAGCGGCCAGCTCAATAAACAGAGTT GATACAATTCGGGTTCCTACCCTTGTTATCAATTCCAGGGATGATCCTGTTGTCGGCCCA GATCAACCATACTCAATCGTGGAAAAGAATCCTCGTATTTTGTATTGTAGAACCGATTTA GGTGGTCATTTAGCTTACCTAGATAAAGACAACAACTCGTGGGCTACCAAGGCAATTGCA GAATTTTTCACTAAGTTTGATGAATTAGTCGTATGA
Protein Properties
Pfam Domain Function
Protein Residues451
Protein Molecular Weight51254.80078
Protein Theoretical pI7.92
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Medium-chain fatty acid ethyl ester synthase/esterase 2 MSEVSKWPAINPFHWGYNGTVSHIVGENGSIKLHLKDNKEQVDFDEFANKYVPTLKNGAQ FKLSPYLFTGILQTLYLGAADFSKKFPVFYGREIVKFSDGGVCTADWLIDSWKKDYEFDQ STTSFDKKKFDKDEKATHPEGWPRLQPRTRYLKDNELEELREVDLPLVVILHGLAGGSHE PIIRSLAENLSRSGRFQVVVLNTRGCARSKITTRNLFTAYHTMDIREFLQREKQRHPDRK LYAVGCSFGATMLANYLGEEGDKSPLSAAATLCNPWDLLLSAIRMSQDWWSRTLFSKNIA QFLTRTVQVNMGELGVPNGSLPDHPPTVKNPSFYMFTPENLIKAKSFKSTREFDEVYTAP ALGFPNAMEYYKAASSINRVDTIRVPTLVINSRDDPVVGPDQPYSIVEKNPRILYCRTDL GGHLAYLDKDNNSWATKAIAEFFTKFDELVV
References
External Links
ResourceLink
Saccharomyces Genome Database EHT1
Uniprot IDP38295
Uniprot NameMCFS2_YEAST
GenBank Gene IDZ36046
Genebank Protein ID536527
General Reference
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Saerens, S. M., Verstrepen, K. J., Van Laere, S. D., Voet, A. R., Van Dijck, P., Delvaux, F. R., Thevelein, J. M. (2006). "The Saccharomyces cerevisiae EHT1 and EEB1 genes encode novel enzymes with medium-chain fatty acid ethyl ester synthesis and hydrolysis capacity." J Biol Chem 281:4446-4456.16361250