You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name3-ketoacyl-CoA reductase
Synonyms
  • 3-ketoreductase
  • KAR
  • Microsomal beta-keto-reductase
Gene NameIFA38
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionComponent of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids
Cellular LocationEndoplasmic reticulum membrane; Single-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
NADPH + hydron + 3-oxoicosanoyl-CoANADP + 3-hydroxyicosanoyl-CoA
NADPH + hydron + 3-oxodocosanoyl-CoANADP + 3-hydroxydocosanoyl-CoA
3-oxotetracosanoyl-CoA + NADPH + hydronNADP + 3-hydroxytetracosanoyl-CoA
NADPH + hydron + 3-oxohexacosanoyl-CoANADP + (S)-3-hydroxyhexacosanoyl-CoA
NADPH + hydron + 3-oxopalmitoyl-CoANADP + (S)-3-hydroxypalmitoyl-CoA
Metabolites
YMDB IDNameView
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00468(S)-3-hydroxypalmitoyl-CoAShow
YMDB004713-hydroxyoctadecanoyl-CoAShow
YMDB00473(S)-3-hydroxytetradecanoyl-CoAShow
YMDB004763-oxopalmitoyl-CoAShow
YMDB004773-oxooctadecanoyl-CoAShow
YMDB004783-oxotetradecanoyl-CoAShow
YMDB007313-hydroxyicosanoyl-CoAShow
YMDB007323-oxoicosanoyl-CoAShow
YMDB007333-oxodocosanoyl-CoAShow
YMDB007343-hydroxydocosanoyl-CoAShow
YMDB007353-oxotetracosanoyl-CoAShow
YMDB007363-hydroxytetracosanoyl-CoAShow
YMDB00862hydronShow
YMDB00959(S)-3-hydroxyhexacosanoyl-CoAShow
YMDB009603-oxohexacosanoyl-CoAShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
binding
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR159W
Gene Sequence>1044 bp ATGACTTTTATGCAACAGCTTCAAGAGGCTGGGGAAAGATTTAGGTGTATCAATGGTCTT TTATGGGTTGTTTTTGGGCTTGGTGTCTTAAAATGTACAACGTTATCACTTAGATTTTTA GCTCTTATTTTTGATCTTTTTTTACTACCAGCAGTCAATTTCGACAAGTATGGTGCTAAA ACTGGTAAATACTGTGCTATCACTGGTGCAAGTGACGGTATTGGTAAAGAATTTGCTAGA CAAATGGCGAAACGTGGCTTCAACTTGGTATTGATCTCGAGAACGCAATCTAAATTGGAG GCTTTACAAAAAGAACTAGAAGATCAACATCATGTCGTTGTAAAGATTCTAGCCATTGAC ATTGCGGAGGATAAAGAATCCAACTATGAATCCATTAAGGAATTGTGTGCGCAGTTACCA ATCACCGTTTTGGTCAATAATGTTGGTCAATCACACTCCATTCCTGTTCCATTTTTGGAA ACAGAAGAGAAGGAGCTTAGAAATATTATCACTATCAATAACACTGCTACATTATTAATT ACACAAATCATTGCACCAAAGATTGTGGAAACTGTGAAAGCTGAAAACAAGAAGTCGGGT ACTCGTGGTTTGATCTTAACCATGGGCTCATTTGGTGGTCTGATTCCCACCCCACTTTTG GCTACATACAGTGGTTCGAAATCATTCTTACAAGGTTGGTCTAACTCTTTGGCTGGGGAA TTATCTAAAGATGCTATCGATGTTGAATTAATCATTTCATATTTGGTCACTAGCTCGATG TCTAAAATCAGAAGATCATCTTTAATGATCCCAAATCCACAACAGTTTGTAAAATCCACT TTAAGAAGCGTTGGCAGACGCTGCGGCTCTCAAGAAAGATACGCTACTATGACCCCTTAC TGGGCGCACGCAGTGTATCAATTTGTAATTACAGAGACCTTTGGCGTTTACTCTAAGATT GTTAACTCCATTAATTATTCCTTCCATAAATCTATCAGAATTAGAGCCTTAAAAAAAGCC GCAAGACAGGTTAAAAAGGAATAG
Protein Properties
Pfam Domain Function
Protein Residues347
Protein Molecular Weight38707.80078
Protein Theoretical pI10.01
Signalling Regions
  • None
Transmembrane Regions
  • 20-40
Protein Sequence>3-ketoacyl-CoA reductase MTFMQQLQEAGERFRCINGLLWVVFGLGVLKCTTLSLRFLALIFDLFLLPAVNFDKYGAK TGKYCAITGASDGIGKEFARQMAKRGFNLVLISRTQSKLEALQKELEDQHHVVVKILAID IAEDKESNYESIKELCAQLPITVLVNNVGQSHSIPVPFLETEEKELRNIITINNTATLLI TQIIAPKIVETVKAENKKSGTRGLILTMGSFGGLIPTPLLATYSGSKSFLQGWSNSLAGE LSKDAIDVELIISYLVTSSMSKIRRSSLMIPNPQQFVKSTLRSVGRRCGSQERYATMTPY WAHAVYQFVITETFGVYSKIVNSINYSFHKSIRIRALKKAARQVKKE
References
External Links
ResourceLink
Saccharomyces Genome Database IFA38
Uniprot IDP38286
Uniprot NameMKAR_YEAST
GenBank Gene IDAY557868
Genebank Protein ID45269627
General Reference
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Beaudoin, F., Gable, K., Sayanova, O., Dunn, T., Napier, J. A. (2002). "A Saccharomyces cerevisiae gene required for heterologous fatty acid elongase activity encodes a microsomal beta-keto-reductase." J Biol Chem 277:11481-11488.11792704
  • Han, G., Gable, K., Kohlwein, S. D., Beaudoin, F., Napier, J. A., Dunn, T. M. (2002). "The Saccharomyces cerevisiae YBR159w gene encodes the 3-ketoreductase of the microsomal fatty acid elongase." J Biol Chem 277:35440-35449.12087109
  • Rossler, H., Rieck, C., Delong, T., Hoja, U., Schweizer, E. (2003). "Functional differentiation and selective inactivation of multiple Saccharomyces cerevisiae genes involved in very-long-chain fatty acid synthesis." Mol Genet Genomics 269:290-298.12684876
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956