Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameVery long-chain fatty acid transport protein
SynonymsNot Available
Gene NameFAT1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionMay be involved in long-chain fatty acids uptake, and thus may play a pivotal role in regulating their accessibility prior to metabolic utilization. May play an important role in uptake of these hydrophobic compounds under conditions where fatty acid synthesis is compromised
Cellular LocationMembrane; Multi-pass membrane protein (Potential)
SMPDB Pathways
Biosynthesis of unsaturated fatty acidsPW002403 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biosynthesis of unsaturated fatty acidsec01040 Map01040
SMPDB Reactions
Palmitic acid + Adenosine triphosphate + Coenzyme AAdenosine monophosphate + Pyrophosphate + Palmityl-CoA
KEGG Reactions
Adenosine triphosphate + lignoceric acid + Coenzyme AAdenosine monophosphate + Pyrophosphate + Tetracosanoyl-CoA
Adenosine triphosphate + cerotic acid + Coenzyme AAdenosine monophosphate + Pyrophosphate + hexacosanoyl-CoA
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00069Palmitic acidShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00301Palmityl-CoAShow
YMDB00537hexacosanoyl-CoAShow
YMDB00684lignoceric acidShow
YMDB00785cerotic acidShow
YMDB00909Tetracosanoyl-CoA Show
GO Classification
Component
Not Available
Function
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR041W
Gene Sequence>2010 bp ATGTCTCCCATACAGGTTGTTGTCTTTGCCTTGTCAAGGATTTTCCTGCTATTATTCAGA CTTATCAAGCTAATTATAACCCCTATCCAGAAATCACTGGGTTATCTATTTGGTAATTAT TTTGATGAATTAGACCGTAAATATAGATACAAGGAGGATTGGTATATTATTCCTTACTTT TTGAAAAGCGTGTTTTGTTATATCATTGATGTGAGAAGACATAGGTTTCAAAACTGGTAC TTATTTATTAAACAGGTCCAACAAAATGGTGACCATTTAGCGATTAGTTACACCCGTCCC ATGGCCGAAAAGGGAGAATTTCAACTCGAAACCTTTACGTATATTGAAACTTATAACATA GTGTTGAGATTGTCTCATATTTTGCATTTTGATTATAACGTTCAGGCCGGTGACTACGTG GCAATCGATTGTACTAATAAACCTCTTTTCGTATTTTTATGGCTTTCTTTGTGGAACATT GGGGCTATTCCAGCTTTTTTAAACTATAATACTAAAGGCACTCCGCTGGTTCACTCCCTA AAGATTTCCAATATTACGCAGGTATTTATTGACCCTGATGCCAGTAATCCGATCAGAGAA TCGGAAGAAGAAATCAAAAACGCACTTCCTGATGTTAAATTAAACTATCTTGAAGAACAA GACTTAATGCATGAACTTTTAAATTCGCAATCACCGGAATTCTTACAACAAGACAACGTT AGGACACCACTAGGCTTGACCGATTTTAAACCCTCTATGTTAATTTATACATCTGGAACC ACTGGTTTGCCTAAATCCGCTATTATGTCTTGGAGAAAATCCTCCGTAGGTTGTCAAGTT TTTGGTCATGTTTTACATATGACTAATGAAAGCACTGTGTTCACAGCCATGCCATTGTTC CATTCAACTGCTGCCTTATTAGGTGCGTGCGCCATTCTATCTCACGGTGGTTGCCTTGCG TTATCGCATAAATTTTCTGCCAGTACATTTTGGAAGCAAGTTTATTTAACAGGAGCCACG CACATCCAATATGTCGGAGAAGTCTGTAGATACCTGTTACATACGCCAATTTCTAAGTAT GAAAAGATGCATAAGGTGAAGGTTGCTTATGGTAACGGGCTGAGACCTGACATCTGGCAG GACTTCAGGAAGAGGTTCAACATAGAAGTTATTGGTGAATTCTATGCCGCAACTGAAGCT CCTTTTGCTACAACTACCTTCCAGAAAGGTGACTTTGGAATTGGCGCATGTAGGAACTAT GGTACTATAATTCAATGGTTTTTGTCATTCCAACAAACATTGGTAAGGATGGACCCAAAT GACGATTCCGTTATATATAGAAATTCCAAGGGTTTCTGCGAAGTGGCCCCTGTTGGCGAA CCAGGAGAAATGTTAATGAGAATCTTTTTCCCTAAAAAACCAGAAACATCTTTTCAAGGT TATCTTGGTAATGCCAAGGAAACAAAGTCCAAAGTTGTGAGGGATGTCTTCAGACGTGGC GATGCTTGGTATAGATGTGGAGATTTATTAAAAGCGGACGAATATGGATTATGGTATTTC CTTGATAGAATGGGTGATACTTTCAGATGGAAATCTGAAAATGTTTCCACTACTGAAGTA GAAGATCAGTTGACGGCCAGTAACAAAGAACAATATGCACAAGTTCTAGTTGTTGGTATT AAAGTACCTAAATATGAAGGTAGAGCTGGTTTTGCAGTTATTAAACTAACTGACAACTCT CTTGACATCACTGCAAAGACCAAATTATTAAATGATTCCTTGAGCCGGTTAAATCTACCG TCTTATGCTATGCCCCTATTTGTTAAATTTGTTGATGAAATTAAAATGACAGATAATCAT AAAATTTTGAAGAAGGTTTATAGAGAGCAAAAATTACCAAAGGGTTTGGATGGAAATGAC ACTATTTTTTGGCTCAAGAATTACAAGCGCTATGAAGTCTTGACCGCTGCTGATTGGGAA GCCATCGATGCACAAACAATTAAATTATGA
Protein Properties
Pfam Domain Function
Protein Residues669
Protein Molecular Weight77140.29688
Protein Theoretical pI8.52
Signalling Regions
  • None
Transmembrane Regions
  • 6-26
  • 54-71
  • 149-169
  • 293-313
Protein Sequence>Very long-chain fatty acid transport protein MSPIQVVVFALSRIFLLLFRLIKLIITPIQKSLGYLFGNYFDELDRKYRYKEDWYIIPYF LKSVFCYIIDVRRHRFQNWYLFIKQVQQNGDHLAISYTRPMAEKGEFQLETFTYIETYNI VLRLSHILHFDYNVQAGDYVAIDCTNKPLFVFLWLSLWNIGAIPAFLNYNTKGTPLVHSL KISNITQVFIDPDASNPIRESEEEIKNALPDVKLNYLEEQDLMHELLNSQSPEFLQQDNV RTPLGLTDFKPSMLIYTSGTTGLPKSAIMSWRKSSVGCQVFGHVLHMTNESTVFTAMPLF HSTAALLGACAILSHGGCLALSHKFSASTFWKQVYLTGATHIQYVGEVCRYLLHTPISKY EKMHKVKVAYGNGLRPDIWQDFRKRFNIEVIGEFYAATEAPFATTTFQKGDFGIGACRNY GTIIQWFLSFQQTLVRMDPNDDSVIYRNSKGFCEVAPVGEPGEMLMRIFFPKKPETSFQG YLGNAKETKSKVVRDVFRRGDAWYRCGDLLKADEYGLWYFLDRMGDTFRWKSENVSTTEV EDQLTASNKEQYAQVLVVGIKVPKYEGRAGFAVIKLTDNSLDITAKTKLLNDSLSRLNLP SYAMPLFVKFVDEIKMTDNHKILKKVYREQKLPKGLDGNDTIFWLKNYKRYEVLTAADWE AIDAQTIKL
References
External Links
ResourceLink
Saccharomyces Genome Database FAT1
Uniprot IDP38225
Uniprot NameFAT1_YEAST
GenBank Gene IDAF065148
Genebank Protein ID3152696
General Reference
  • Faergeman, N. J., DiRusso, C. C., Elberger, A., Knudsen, J., Black, P. N. (1997). "Disruption of the Saccharomyces cerevisiae homologue to the murine fatty acid transport protein impairs uptake and growth on long-chain fatty acids." J Biol Chem 272:8531-8538.9079682
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106