You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphatidate cytidylyltransferase
Synonyms
  • CDP-DAG synthase
  • CDP-DG synthase
  • CDP-diacylglycerol synthase
  • CDS
  • CDP-diglyceride pyrophosphorylase
  • CDP-diglyceride synthase
  • CTP:phosphatidate cytidylyltransferase
Gene NameCDS1
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring phosphorus-containing groups
Specific FunctionSupplies CDP-diacylglycerol, which may play an important role as both a precursor to phosphoinositide biosynthesis in the plasma membrane and as a negative effector of phosphatidylinositol 4-kinase activity, thereby exerting an effect on cell proliferation via a lipid-dependent signal transduction cascade
Cellular LocationMitochondrion membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB Pathways
Cardiolipin BiosynthesisPW002431 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/28:0)PW003484 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/30:0)PW003501 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/26:0)PW003502 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/28:0)PW003503 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
PA(16:0/16:0) + hydron + Cytidine triphosphatePyrophosphate + CDP-DG(16:0/16:0)
DG(16:0/16:0/0:0) + hydron + Cytidine triphosphateCDP-DG(16:0/16:0) + Pyrophosphate
PA(16:0/16:0) + hydron + Cytidine triphosphate Pyrophosphate + CDP-DG(16:0/16:0)
PA(16:0/16:0) + hydron + Cytidine triphosphatePyrophosphate + CDP-DG(14:0/14:0)
PA(14:0/14:0) + hydron + Cytidine triphosphatePyrophosphate + CDP-DG(14:0/14:0)
KEGG Reactions
LPA(16:0/0:0) + hydron + Cytidine triphosphatePyrophosphate + CDP-diacylglycerol
Metabolites
YMDB IDNameView
YMDB00219PyrophosphateShow
YMDB00279Cytidine triphosphateShow
YMDB00862hydronShow
YMDB01127DG(16:0/16:0/0:0)Show
YMDB01161PA(16:0/16:0)Show
YMDB12067CDP-DG(10:0/10:0)Show
YMDB12068CDP-DG(10:0/12:0)Show
YMDB12069CDP-DG(10:0/14:0)Show
YMDB12070CDP-DG(10:0/14:1(11Z))Show
YMDB12071CDP-DG(10:0/14:1(9Z))Show
YMDB12072CDP-DG(10:0/15:0)Show
YMDB12073CDP-DG(10:0/15:1(11Z))Show
YMDB12074CDP-DG(10:0/15:1(9Z))Show
YMDB12075CDP-DG(10:0/16:0)Show
YMDB12076CDP-DG(10:0/16:1(11Z))Show
YMDB12077CDP-DG(10:0/16:1(9Z))Show
YMDB12078CDP-DG(10:0/18:0)Show
YMDB12079CDP-DG(10:0/18:1(11Z))Show
YMDB12080CDP-DG(10:0/18:1(9Z))Show
YMDB12081CDP-DG(10:0/20:0)Show
YMDB12082CDP-DG(10:0/20:1(11Z))Show
YMDB12083CDP-DG(10:0/20:1(13Z))Show
YMDB12084CDP-DG(10:0/22:0)Show
YMDB12086CDP-DG(10:0/22:1(9Z))Show
YMDB12087CDP-DG(10:0/23:1(11Z))Show
YMDB12088CDP-DG(10:0/23:1(9Z))Show
YMDB12089CDP-DG(10:0/24:0)Show
YMDB12090CDP-DG(10:0/24:1(11Z))Show
YMDB12091CDP-DG(10:0/24:1(9Z))Show
YMDB12092CDP-DG(10:0/25:0)Show
YMDB12093CDP-DG(10:0/25:1(11Z))Show
YMDB12094CDP-DG(10:0/25:1(9Z))Show
YMDB12095CDP-DG(10:0/26:0)Show
YMDB12096CDP-DG(10:0/26:1(11Z))Show
YMDB12097CDP-DG(10:0/26:1(9Z))Show
YMDB12100CDP-DG(12:0/12:0)Show
YMDB12101CDP-DG(12:0/14:0)Show
YMDB12102CDP-DG(12:0/14:1(11Z))Show
YMDB12103CDP-DG(12:0/14:1(9Z))Show
YMDB12104CDP-DG(12:0/15:0)Show
YMDB12105CDP-DG(12:0/15:1(11Z))Show
YMDB12106CDP-DG(12:0/15:1(9Z))Show
YMDB12107CDP-DG(12:0/16:0)Show
YMDB12108CDP-DG(12:0/16:1(11Z))Show
YMDB12109CDP-DG(12:0/16:1(9Z))Show
YMDB12110CDP-DG(12:0/18:0)Show
YMDB12111CDP-DG(12:0/18:1(11Z))Show
YMDB12112CDP-DG(12:0/18:1(9Z))Show
YMDB12113CDP-DG(12:0/20:0)Show
YMDB12114CDP-DG(12:0/20:1(11Z))Show
YMDB12115CDP-DG(12:0/20:1(13Z))Show
YMDB12116CDP-DG(12:0/22:0)Show
YMDB12118CDP-DG(12:0/22:1(9Z))Show
YMDB12119CDP-DG(12:0/23:1(11Z))Show
YMDB12120CDP-DG(12:0/23:1(9Z))Show
YMDB12121CDP-DG(12:0/24:0)Show
YMDB12122CDP-DG(12:0/24:1(11Z))Show
YMDB12123CDP-DG(12:0/24:1(9Z))Show
YMDB12131CDP-DG(14:0/14:0)Show
YMDB12132CDP-DG(14:0/14:1(11Z))Show
YMDB12133CDP-DG(14:0/14:1(9Z))Show
YMDB12134CDP-DG(14:0/15:0)Show
YMDB12135CDP-DG(14:0/15:1(11Z))Show
YMDB12136CDP-DG(14:0/15:1(9Z))Show
YMDB12137CDP-DG(14:0/16:0)Show
YMDB12138CDP-DG(14:0/16:1(11Z))Show
YMDB12139CDP-DG(14:0/16:1(9Z))Show
YMDB12140CDP-DG(14:0/18:0)Show
YMDB12141CDP-DG(14:0/18:1(11Z))Show
YMDB12142CDP-DG(14:0/18:1(9Z))Show
YMDB12143CDP-DG(14:0/20:0)Show
YMDB12144CDP-DG(14:0/20:1(11Z))Show
YMDB12145CDP-DG(14:0/20:1(13Z))Show
YMDB12146CDP-DG(14:0/22:0)Show
YMDB12148CDP-DG(14:0/22:1(9Z))Show
YMDB12159CDP-DG(14:1(11Z)/14:1(11Z))Show
YMDB12160CDP-DG(14:1(11Z)/14:1(9Z))Show
YMDB12161CDP-DG(14:1(11Z)/15:0)Show
YMDB12162CDP-DG(14:1(11Z)/15:1(11Z))Show
YMDB12163CDP-DG(14:1(11Z)/15:1(9Z))Show
YMDB12164CDP-DG(14:1(11Z)/16:0)Show
YMDB12165CDP-DG(14:1(11Z)/16:1(11Z))Show
YMDB12166CDP-DG(14:1(11Z)/16:1(9Z))Show
YMDB12167CDP-DG(14:1(11Z)/18:0)Show
YMDB12168CDP-DG(14:1(11Z)/18:1(11Z))Show
YMDB12169CDP-DG(14:1(11Z)/18:1(9Z))Show
YMDB12170CDP-DG(14:1(11Z)/20:0)Show
YMDB12171CDP-DG(14:1(11Z)/20:1(11Z))Show
YMDB12172CDP-DG(14:1(11Z)/20:1(13Z))Show
YMDB12173CDP-DG(14:1(11Z)/22:0)Show
YMDB12175CDP-DG(14:1(11Z)/22:1(9Z))Show
YMDB12186CDP-DG(14:1(9Z)/14:1(11Z))Show
YMDB12187CDP-DG(14:1(9Z)/14:1(9Z))Show
YMDB12188CDP-DG(14:1(9Z)/15:0)Show
YMDB12189CDP-DG(14:1(9Z)/15:1(11Z))Show
YMDB12190CDP-DG(14:1(9Z)/15:1(9Z))Show
YMDB12191CDP-DG(14:1(9Z)/16:0)Show
YMDB12192CDP-DG(14:1(9Z)/16:1(11Z))Show
YMDB12193CDP-DG(14:1(9Z)/16:1(9Z))Show
YMDB12194CDP-DG(14:1(9Z)/18:0)Show
YMDB12195CDP-DG(14:1(9Z)/18:1(11Z))Show
YMDB12196CDP-DG(14:1(9Z)/18:1(9Z))Show
YMDB12197CDP-DG(14:1(9Z)/20:0)Show
YMDB12198CDP-DG(14:1(9Z)/20:1(11Z))Show
YMDB12199CDP-DG(14:1(9Z)/20:1(13Z))Show
YMDB12200CDP-DG(14:1(9Z)/22:0)Show
YMDB12202CDP-DG(14:1(9Z)/22:1(9Z))Show
YMDB12213CDP-DG(15:0/15:0)Show
YMDB12214CDP-DG(15:0/15:1(11Z))Show
YMDB12215CDP-DG(15:0/15:1(9Z))Show
YMDB12216CDP-DG(15:0/16:0)Show
YMDB12217CDP-DG(15:0/16:1(11Z))Show
YMDB12218CDP-DG(15:0/16:1(9Z))Show
YMDB12219CDP-DG(15:0/18:0)Show
YMDB12220CDP-DG(15:0/18:1(11Z))Show
YMDB12221CDP-DG(15:0/18:1(9Z))Show
YMDB12222CDP-DG(15:0/20:0)Show
YMDB12223CDP-DG(15:0/20:1(11Z))Show
YMDB12224CDP-DG(15:0/20:1(13Z))Show
YMDB12247CDP-DG(15:1(11Z)/15:1(11Z))Show
YMDB12248CDP-DG(15:1(11Z)/15:1(9Z))Show
YMDB12249CDP-DG(15:1(11Z)/16:0)Show
YMDB12250CDP-DG(15:1(11Z)/16:1(11Z))Show
YMDB12251CDP-DG(15:1(11Z)/16:1(9Z))Show
YMDB12252CDP-DG(15:1(11Z)/18:0)Show
YMDB12253CDP-DG(15:1(11Z)/18:1(11Z))Show
YMDB12254CDP-DG(15:1(11Z)/18:1(9Z))Show
YMDB12255CDP-DG(15:1(11Z)/20:0)Show
YMDB12256CDP-DG(15:1(11Z)/20:1(11Z))Show
YMDB12257CDP-DG(15:1(11Z)/20:1(13Z))Show
YMDB12280CDP-DG(15:1(9Z)/15:1(11Z))Show
YMDB12281CDP-DG(15:1(9Z)/15:1(9Z))Show
YMDB12282CDP-DG(15:1(9Z)/16:0)Show
YMDB12283CDP-DG(15:1(9Z)/16:1(11Z))Show
YMDB12284CDP-DG(15:1(9Z)/16:1(9Z))Show
YMDB12285CDP-DG(15:1(9Z)/18:0)Show
YMDB12286CDP-DG(15:1(9Z)/18:1(11Z))Show
YMDB12287CDP-DG(15:1(9Z)/18:1(9Z))Show
YMDB12288CDP-DG(15:1(9Z)/20:0)Show
YMDB12289CDP-DG(15:1(9Z)/20:1(11Z))Show
YMDB12290CDP-DG(15:1(9Z)/20:1(13Z))Show
YMDB12313CDP-DG(16:0/16:0)Show
YMDB12314CDP-DG(16:0/16:1(11Z))Show
YMDB12315CDP-DG(16:0/16:1(9Z))Show
YMDB12316CDP-DG(16:0/18:0)Show
YMDB12317CDP-DG(16:0/18:1(11Z))Show
YMDB12318CDP-DG(16:0/18:1(9Z))Show
YMDB12319CDP-DG(16:0/20:0)Show
YMDB12320CDP-DG(16:0/20:1(11Z))Show
YMDB12321CDP-DG(16:0/20:1(13Z))Show
YMDB12344CDP-DG(16:1(11Z)/16:1(11Z))Show
YMDB12345CDP-DG(16:1(11Z)/16:1(9Z))Show
YMDB12346CDP-DG(16:1(11Z)/18:0)Show
YMDB12347CDP-DG(16:1(11Z)/18:1(11Z))Show
YMDB12348CDP-DG(16:1(11Z)/18:1(9Z))Show
YMDB12349CDP-DG(16:1(11Z)/20:0)Show
YMDB12350CDP-DG(16:1(11Z)/20:1(11Z))Show
YMDB12351CDP-DG(16:1(11Z)/20:1(13Z))Show
YMDB12374CDP-DG(16:1(9Z)/16:1(11Z))Show
YMDB12375CDP-DG(16:1(9Z)/16:1(9Z))Show
YMDB12460CDP-DG(18:1(9Z)/18:1(9Z))Show
GO Classification
Component
membrane
cell part
Function
transferase activity, transferring phosphorus-containing groups
catalytic activity
transferase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 2
LocusYBR029C
Gene Sequence>1374 bp ATGTCTGACAACCCTGAGATGAAACCACATGGTACGAGCAAGGAGATTGTGGAGTCGGTT ACTGACGCCACCTCAAAGGCGATTGATAAATTGCAAGAAGAACTCCACAAGGACGCCAGC GAATCCGTCACGCCGGTGACCAAGGAAAGCACTGCTGCTACAAAGGAAAGCAGGAAATAC AACTTTTTCATTAGAACAGTTTGGACGTTTGTTATGATCAGTGGTTTCTTCATCACCTTA GCATCGGGTCATGCATGGTGTATAGTGCTGATTTTGGGCTGCCAAATTGCTACTTTTAAA GAGTGTATTGCCGTAACAAGTGCATCTGGTCGCGAAAAGAATTTGCCATTGACAAAGACG TTGAACTGGTACCTTCTCTTCACCACTATCTATTACTTAGATGGGAAATCACTCTTCAAG TTTTTCCAAGCTACTTTTTACGAGTATCCTGTATTGAACTTTATCGTAACAAATCATAAG TTTATCTGCTATTGTCTCTATCTTATGGGATTTGTTCTGTTCGTTTGTAGTTTAAGAAAG GGATTTTTGAAATTCCAGTTCGGATCATTGTGCGTTACTCATATGGTTCTTCTTCTGGTA GTATTTCAGGCTCATTTGATCATCAAAAACGTGCTCAATGGGCTATTCTGGTTCTTATTA CCATGCGGGTTGGTAATTGTTAATGATATCTTCGCCTACCTGTGCGGCATTACATTCGGT AAGACTAAACTAATAGAAATCTCGCCCAAGAAAACTTTAGAAGGTTTCCTTGGTGCCTGG TTTTTCACTGCTCTAGCTAGTATTATATTAACAAGGATTCTGAGCCCTTATACTTACTTG ACGTGCCCTGTTGAAGATCTCCATACCAATTTTTTCTCTAATTTGACATGTGAACTAAAC CCAGTTTTCCTTCCACAAGTTTACAGACTTCCACCCATCTTTTTCGATAAAGTTCAAATC AATTCAATTACAGTAAAACCAATTTATTTCCATGCTTTAAACTTAGCTACCTTTGCATCA TTATTTGCGCCATTTGGAGGCTTTTTCGCATCTGGTCTAAAGAGAACTTTTAAAGTTAAA GACTTTGGCCACTCCATCCCAGGCCATGGTGGTATCACAGACAGGGTTGATTGCCAATTC ATAATGGGTTCTTTTGCCAATTTGTACTATGAAACATTCATCAGCGAACACAGAATAACA GTAGATACAGTTTTATCCACTATTTTAATGAACCTGAACGACAAGCAGATTATAGAATTG ATTGATATCTTGATTAGATTCCTATCTAAAAAAGGTATAATATCAGCGAAGAATTTTGAA AAGTTGGCTGACATCTTTAATGTGACCAAGAAATCATTGACCAATCACTCATGA
Protein Properties
Pfam Domain Function
Protein Residues457
Protein Molecular Weight51822.39844
Protein Theoretical pI8.74
Signalling Regions
  • None
Transmembrane Regions
  • 71-91
  • 154-174
  • 188-208
  • 214-234
  • 255-275
  • 330-350
Protein Sequence>Phosphatidate cytidylyltransferase MSDNPEMKPHGTSKEIVESVTDATSKAIDKLQEELHKDASESVTPVTKESTAATKESRKY NFFIRTVWTFVMISGFFITLASGHAWCIVLILGCQIATFKECIAVTSASGREKNLPLTKT LNWYLLFTTIYYLDGKSLFKFFQATFYEYPVLNFIVTNHKFICYCLYLMGFVLFVCSLRK GFLKFQFGSLCVTHMVLLLVVFQAHLIIKNVLNGLFWFLLPCGLVIVNDIFAYLCGITFG KTKLIEISPKKTLEGFLGAWFFTALASIILTRILSPYTYLTCPVEDLHTNFFSNLTCELN PVFLPQVYRLPPIFFDKVQINSITVKPIYFHALNLATFASLFAPFGGFFASGLKRTFKVK DFGHSIPGHGGITDRVDCQFIMGSFANLYYETFISEHRITVDTVLSTILMNLNDKQIIEL IDILIRFLSKKGIISAKNFEKLADIFNVTKKSLTNHS
References
External Links
ResourceLink
Saccharomyces Genome Database CDS1
Uniprot IDP38221
Uniprot NameCDS1_YEAST
GenBank Gene IDAY693074
Genebank Protein ID51013599
General Reference
  • Shen, H., Heacock, P. N., Clancey, C. J., Dowhan, W. (1996). "The CDS1 gene encoding CDP-diacylglycerol synthase in Saccharomyces cerevisiae is essential for cell growth." J Biol Chem 271:789-795.8557688
  • Smits, P. H., De Haan, M., Maat, C., Grivell, L. A. (1994). "The complete sequence of a 33 kb fragment on the right arm of chromosome II from Saccharomyces cerevisiae reveals 16 open reading frames, including ten new open reading frames, five previously identified genes and a homologue of the SCO1 gene." Yeast 10 Suppl A:S75-S80.8091864
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Shen, H., Dowhan, W. (1996). "Reduction of CDP-diacylglycerol synthase activity results in the excretion of inositol by Saccharomyces cerevisiae." J Biol Chem 271:29043-29048.8910557