You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMethionine aminopeptidase 2
Synonyms
  • MetAP 2
  • Peptidase M 2
Gene NameMAP2
Enzyme Class
Biological Properties
General FunctionInvolved in aminopeptidase activity
Specific FunctionRemoves the amino-terminal methionine from nascent proteins
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00318L-MethionineShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
hydrolase activity
peptidase activity
peptidase activity, acting on L-amino acid peptides
metallopeptidase activity
metalloexopeptidase activity
exopeptidase activity
aminopeptidase activity
Process
metabolic process
macromolecule metabolic process
cellular process
protein metabolic process
proteolysis
Gene Properties
Chromosome Locationchromosome 2
LocusYBL091C
Gene Sequence>1266 bp ATGACAGACGCTGAAATAGAAAATTCCCCTGCTTCTGATTTAAAAGAATTGAATTTGGAG AATGAAGGCGTTGAACAGCAAGACCAGGCAAAAGCTGACGAGTCAGACCCAGTAGAAAGC AAAAAGAAGAAGAACAAGAAAAAGAAGAAGAAGAAAAGCAATGTGAAGAAGATTGAATTA CTGTTTCCAGATGGAAAGTACCCAGAAGGTGCGTGGATGGACTATCATCAAGATTTCAAT CTGCAAAGAACCACGGATGAAGAATCACGTTATTTGAAAAGGGATCTGGAAAGGGCCGAA CATTGGAATGATGTCAGAAAGGGTGCTGAGATACATCGTCGTGTGAGAAGGGCCATCAAG GACAGAATCGTTCCTGGGATGAAGTTAATGGATATCGCTGACATGATCGAAAATACTACA AGAAAGTATACAGGTGCCGAAAATTTATTAGCGATGGAGGATCCCAAATCTCAAGGTATT GGGTTTCCAACGGGTCTCTCTCTCAACCATTGTGCTGCACATTTCACACCCAATGCAGGC GACAAAACCGTTCTGAAATACGAAGACGTGATGAAGGTAGATTATGGTGTGCAGGTAAAC GGTAACATCATTGATTCTGCCTTTACTGTTTCCTTTGATCCACAATACGATAACCTGCTA GCCGCTGTAAAGGACGCTACTTACACGGGTATTAAAGAAGCGGGTATCGATGTGAGATTA ACCGACATCGGTGAAGCCATCCAAGAAGTTATGGAATCCTACGAAGTGGAAATCAATGGT GAGACTTACCAGGTTAAACCTTGTCGTAATCTATGTGGCCACAGTATCGCACCATATCGT ATCCACGGCGGTAAATCCGTTCCCATCGTCAAAAATGGGGACACTACAAAAATGGAGGAA GGTGAGCACTTTGCCATTGAAACTTTTGGTTCTACTGGTAGAGGTTATGTTACTGCCGGT GGGGAAGTTTCTCATTATGCCAGATCTGCTGAAGACCATCAGGTAATGCCCACGTTAGAC AGCGCCAAGAACTTGTTAAAAACGATAGACCGCAACTTTGGGACTTTACCGTTCTGTCGC CGATACCTAGACAGACTTGGCCAAGAGAAATACTTATTTGCGTTGAATAACTTGGTTAGA CACGGTTTAGTACAGGATTATCCACCATTGAACGATATCCCCGGATCCTACACTGCACAA TTCGAACACACCATCTTGTTGCATGCTCACAAAAAGGAAGTCGTTTCGAAAGGTGATGAC TACTGA
Protein Properties
Pfam Domain Function
Protein Residues421
Protein Molecular Weight47502.19922
Protein Theoretical pI6.29
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Methionine aminopeptidase 2 MTDAEIENSPASDLKELNLENEGVEQQDQAKADESDPVESKKKKNKKKKKKKSNVKKIEL LFPDGKYPEGAWMDYHQDFNLQRTTVEESRYLKRDLERAEHWNDVRKGAEIHRRVRRAIK DRIVPGMKLMDIADMIENTTRKYTGAENLLAMEDPKSQGIGFPTGLSLNHCAAHFTPNAG DKTVLKYEDVMKVDYGVQVNGNIIDSAFTVSFDPQYDNLLAAVKDATYTGIKEAGIDVRL TDIGEAIQEVMESYEVEINGETYQVKPCRNLCGHSIAPYRIHGGKSVPIVKNGDTTKMEE GEHFAIETFGSTGRGYVTAGGEVSHYARSAEDHQVMPTLDSAKNLLKTIDRNFGTLPFCR RYLDRLGQEKYLFALNNLVRHGLVQDYPPLNDIPGSYTAQFEHTILLHAHKKEVVSKGDD Y
References
External Links
ResourceLink
Saccharomyces Genome Database MAP2
Uniprot IDP38174
Uniprot NameAMPM2_YEAST
GenBank Gene IDU17437
Genebank Protein ID1045302
General Reference
  • Li, X., Chang, Y. H. (1995). "Amino-terminal protein processing in Saccharomyces cerevisiae is an essential function that requires two distinct methionine aminopeptidases." Proc Natl Acad Sci U S A 92:12357-12361.8618900
  • Obermaier, B., Gassenhuber, J., Piravandi, E., Domdey, H. (1995). "Sequence analysis of a 78.6 kb segment of the left end of Saccharomyces cerevisiae chromosome II." Yeast 11:1103-1112.7502586
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956