You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlpha-glucosidase MAL32
Synonyms
  • Maltase
Gene NameMAL32
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionHydrolysis of terminal, non-reducing (1->4)- linked alpha-D-glucose residues with release of alpha-D-glucose
Cellular LocationNot Available
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Galactose metabolismec00052 Map00052
Starch and sucrose metabolismec00500 Map00500
SMPDB ReactionsNot Available
KEGG Reactions
Maltose + waterD-Glucose
Metabolites
YMDB IDNameView
YMDB00273Alpha-D-GlucoseShow
YMDB00286D-GlucoseShow
YMDB00584MaltoseShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
catalytic activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR299W
Gene Sequence>1755 bp ATGACTATTTCTGATCATCCAGAAACAGAACCAAAGTGGTGGAAAGAGGCCACAATCTAT CAAATTTACCCAGCAAGTTTTAAAGACTCCAATAACGATGGCTGGGGTGATTTAAAAGGT ATCACTTCCAAGTTGCAGTATATTAAAGATCTTGGCGTTGATGCTATTTGGGTTTGTCCG TTTTATGACTCTCCTCAACAAGATATGGGGTATGATATATCTAACTACGAAAAGGTCTGG CCCACATACGGTACCAACGAGGACTGTTTTGAGCTAATTGACAAGACTCATAAGCTGGGT ATGAAATTCATCACCGATTTGGTTATCAACCACTGTTCTACAGAACACGAATGGTTCAAA GAGAGCAGATCCTCGAAGACCAATCCGAAGCGTGACTGGTTCTTCTGGAGACCTCCTAAA GGTTATGACGCCGAAGGCAAGCCAATTCCTCCAAACAATTGGAAATCTTTCTTTGGTGGT TCAGCTTGGACTTTTGATGAAACTACAAATGAATTTTACCTCCGTTTGTTTGCGAGTCGT CAAGTTGACTTGAATTGGGAGAATGAAGACTGCAGAAGGGCAATCTTTGAAAGTGCTGTT GGATTTTGGCTGGACCATGGTGTAGATGGTTTTAGAATCGATACCGCTGGTTTGTATTCG AAACGTCCTGGTTTACCAGATTCCCCAATTTTTGACAAAACCTCGAAATTACAACATCCA AATTGGGGGTCTCACAATGGTCCTAGGATTCATGAATATCATCAAGAACTACACAGATTT ATGAAAAACAGGGTGAAAGATGGTAGAGAAATAATGACAGTCGGTGAAGTTGCCCATGGA AGTGATAATGCTTTATACACCAGTGCAGCTAGATACGAAGTCAGCGAAGTTTTCTCCTTC ACGCACGTTGAACTTGGTACCTCGCCATTTTTCCGTTATAACATAGTGCCCTTCACCTTG AAACAATGGAAAGAAGCCATTGCATCGAACTTTTTGTTCATTAACGGTACTGATAGTTGG GCTACCACCTACATCGAGAATCACGATCAAGCCCGGTCAATTACGAGATTTGCTGACGAT TCGCCAAAGTACCGTAAAATATCTGGTAAGCTGTTAACATTGCTAGAATGTTCATTGACA GGTACGTTGTATGTCTATCAAGGTCAGGAGATAGGCCAGATCAATTTCAAGGAATGGCCT ATTGAAAAGTATGAGGACGTTGATGTGAAAAACAACTACGAGATTATCAAAAAAAGTTTT GGTAAAAACTCGAAGGAAATGAAGGATTTTTTTAAAGGAATCGCCCTACTTTCTAGAGAT CATTCGAGAACTCCCATGCCATGGACGAAAGATAAGCCCAATGCTGGATTTACTGGCCCA GATGTTAAACCTTGGTTTTTCTTGAATGAATCTTTTGAGCAAGGAATCAATGTTGAGCAG GAATCCAGAGATGATGACTCAGTTCTCAATTTTTGGAAAAGGGCCTTGCAAGCCAGAAAG AAATATAAGGAACTTATGATTTATGGTTACGATTTCCAATTCATTGATTTAGACAGTGAC CAGATCTTTAGCTTCACTAAAGAGTACGAAGACAAGACGCTGTTTGCTGCTTTGAATTTC AGTGGCGAAGAAATTGAATTCAGCCTCCCAAGAGAAGGTGCTTCTTTATCTTTTATTCTT GGAAATTATGATGATACTGACGTTTCCTCCAGAGTTTTGAAACCATGGGAAGGTAGAATC TACCTCGTCAAATAA
Protein Properties
Pfam Domain Function
Protein Residues584
Protein Molecular Weight68141.79688
Protein Theoretical pI5.44
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Alpha-glucosidase MAL32 MTISDHPETEPKWWKEATIYQIYPASFKDSNNDGWGDLKGITSKLQYIKDLGVDAIWVCP FYDSPQQDMGYDISNYEKVWPTYGTNEDCFELIDKTHKLGMKFITDLVINHCSTEHEWFK ESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSFFGGSAWTFDETTNEFYLRLFASR QVDLNWENEDCRRAIFESAVGFWLDHGVDGFRIDTAGLYSKRPGLPDSPIFDKTSKLQHP NWGSHNGPRIHEYHQELHRFMKNRVKDGREIMTVGEVAHGSDNALYTSAARYEVSEVFSF THVELGTSPFFRYNIVPFTLKQWKEAIASNFLFINGTDSWATTYIENHDQARSITRFADD SPKYRKISGKLLTLLECSLTGTLYVYQGQEIGQINFKEWPIEKYEDVDVKNNYEIIKKSF GKNSKEMKDFFKGIALLSRDHSRTPMPWTKDKPNAGFTGPDVKPWFFLNESFEQGINVEQ ESRDDDSVLNFWKRALQARKKYKELMIYGYDFQFIDLDSDQIFSFTKEYEDKTLFAALNF SGEEIEFSLPREGASLSFILGNYDDTDVSSRVLKPWEGRIYLVK
References
External Links
ResourceLink
Saccharomyces Genome Database MAL32
Uniprot IDP38158
Uniprot NameMAL32_YEAST
GenBank Gene IDZ36168
Genebank Protein ID536762
General Reference
  • Feuermann, M., Charbonnel, L., De Montigny, J., Bloch, J. C., Potier, S., Souciet, J. L. (1995). "Sequence of a 9.8 kb segment of yeast chromosome II including the three genes of the MAL3 locus and three unidentified open reading frames." Yeast 11:667-672.7483839
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106