You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutathione peroxidase 2
SynonymsNot Available
Gene NameGPX2
Enzyme Class
Biological Properties
General FunctionInvolved in glutathione peroxidase activity
Specific FunctionMay constitute a glutathione peroxidase-like protective system against oxidative stresses
Cellular LocationNot Available
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arachidonic acid metabolismec00590 Map00590
Glutathione metabolismec00480 Map00480
SMPDB ReactionsNot Available
KEGG Reactions
Hydrogen peroxide + Glutathionewater + Oxidized glutathione
Metabolites
YMDB IDNameView
YMDB00057Oxidized glutathioneShow
YMDB00160GlutathioneShow
YMDB00693glutathione disulfideShow
YMDB00888Hydrogen peroxideShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
antioxidant activity
peroxidase activity
glutathione peroxidase activity
Process
response to stress
response to oxidative stress
metabolic process
oxidation reduction
response to stimulus
Gene Properties
Chromosome Locationchromosome 2
LocusYBR244W
Gene Sequence>489 bp ATGACCACATCTTTTTATGATTTAGAATGCAAGGACAAGAAAGGCGAATCTTTTAAGTTT GACCAACTGAAAGGCAAAGTAGTTCTCATAGTTAATGTTGCCTCCAAGTGCGGCTTCACG CCGCAGTATAAAGAATTGGAAGAACTATACAAAAAATATCAAGATAAGGGGTTTGTTATT TTGGGGTTCCCATGTAATCAGTTCGGGAAGCAGGAACCGGGCTCTGATGAACAAATTACG GAATTTTGCCAGTTGAATTATGGCGTTACATTCCCAATTATGAAGAAGATTGATGTTAAC GGAAGTAATGCTGACTCTGTCTATAATTATTTGAAAAGCCAAAAAGCAGGTTTACTAGGT TTCAAGGGTATCAAATGGAATTTTGAAAAGTTCTTAGTTGATTCCAATGGTAAGGTTGTC CAAAGATTTTCCTCCTTAACAAAACCATCGTCCTTGGACCAAGAAATCCAAAGCCTGTTA AGTAAATGA
Protein Properties
Pfam Domain Function
Protein Residues162
Protein Molecular Weight18406.0
Protein Theoretical pI8.84
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutathione peroxidase 2 MTTSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVI LGFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLG FKGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLLSK
References
External Links
ResourceLink
Saccharomyces Genome Database GPX2
Uniprot IDP38143
Uniprot NameGPX2_YEAST
GenBank Gene IDAY557641
Genebank Protein ID45269175
General Reference
  • Avery, A. M., Avery, S. V. (2001). "Saccharomyces cerevisiae expresses three phospholipid hydroperoxide glutathione peroxidases." J Biol Chem 276:33730-33735.11445588
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956