You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlucosidase 2 subunit alpha
Synonyms
  • Alpha-glucosidase II subunit alpha
  • Glucosidase II subunit alpha
  • Reversal of TOR2 lethality protein 2
Gene NameROT2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCatalytic subunit of glucosidase 2, which cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins
Cellular LocationEndoplasmic reticulum
SMPDB Pathways
N-Glycan biosynthesisPW002501 ThumbThumb?image type=greyscaleThumb?image type=simple
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
N-Glycan biosynthesisec00510 Map00510
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Alpha-D-Glucose + D-FructoseSucrose + water
Alpha-D-GlucoseGlycogen
DextrinAlpha-D-Glucose
MaltoseAlpha-D-Glucose
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00273Alpha-D-GlucoseShow
YMDB00584MaltoseShow
YMDB00657D-FructoseShow
YMDB00881GlycogenShow
YMDB00890waterShow
YMDB00906SucroseShow
YMDB16192DextrinShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
catalytic activity
Process
primary metabolic process
carbohydrate metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR229C
Gene Sequence>2865 bp ATGGTCCTTTTGAAATGGCTCGTATGCCAATTGGTCTTCTTTACCGCTTTTTCGCATGCG TTTACCGACTATCTATTAAAGAAGTGTGCGCAATCTGGGTTTTGCCATAGAAACAGGGTT TATGCAGAAAATATTGCCAAATCTCATCACTGCTATTACAAAGTGGACGCCGAGTCTATT GCACACGATCCTTTAGAGAATGTGCTTCATGCTACCATAATTAAAACTATACCAAGATTG GAGGGCGATGATATAGCCGTTCAGTTCCCATTCTCTCTCTCTTTTTTACAGGATCACTCA GTAAGGTTCACTATAAATGAGAAAGAGAGAATGCCAACCAACAGCAGCGGTTTGTTGATC TCTTCACAACGGTTCAATGAGACCTGGAAGTACGCATTCGACAAGAAATTTCAAGAGGAG GCGAACAGGACCAGTATTCCACAATTCCACTTCCTTAAGCAAAAACAAACTGTGAACTCA TTCTGGTCGAAAATATCTTCATTTTTGTCACTTTCAAACTCCACTGCAGACACATTTCAT CTTCGAAACGGTGATGTATCCGTAGAAATCTTTGCTGAACCTTTTCAATTGAAAGTTTAC TGGCAAAATGCGCTGAAACTTATTGTAAACGAGCAAAATTTCCTGAACATTGAACATCAT AGAACTAAGCAGGAAAACTTCGCACACGTGCTGCCAGAAGAAACAACTTTCAACATGTTT AAGGACAATTTCTTGTATTCAAAGCATGACTCTATGCCTTTGGGGCCTGAATCGGTTGCG CTAGATTTCTCTTTCATGGGTTCTACTAATGTCTACGGTATACCGGAACATGCGACGTCG CTAAGGCTGATGGACACTTCAGGTGGAAAGGAACCCTACAGGCTTTTCAACGTTGATGTC TTTGAGTACAACATCGGTACCAGCCAACCAATGTACGGTTCGATCCCATTCATGTTTTCA TCTTCGTCCACATCTATCTTTTGGGTCAATGCAGCTGACACTTGGGTAGACATAAAGTAT GACACCAGTAAAAATAAAACGATGACTCATTGGATCTCCGAAAATGGTGTCATAGATGTA GTCATGTCCCTGGGGCCAGATATTCCAACTATCATTGACAAATTTACCGATTTGACTGGT AGACCCTTTTTACCGCCCATTTCCTCTATAGGGTACCATCAATGTAGATGGAATTATAAT GATGAGATGGACGTTCTCACAGTGGACTCTCAGATGGATGCTCATATGATTCCTTACGAT TTTATTTGGTTGGACTTGGAGTATACGAACGACAAAAAATATTTTACTTGGAAGCAGCAC TCCTTTCCCAATCCAAAAAGGCTGTTATCCAAATTAAAAAAGTTGGGTAGAAATCTTGTC GTACTAATCGATCCTCATTTAAAGAAAGATTATGAAATCAGTGACAGGGTAATTAATGAA AATGTAGCAGTCAAGGATCACAATGGAAATGACTATGTAGGTCATTGCTGGCCAGGTAAT TCTATATGGATTGATACCATAAGCAAATATGGCCAAAAGATTTGGAAGTCCTTTTTCGAA CGGTTTATGGATCTGCCGGCTGATTTAACTAATTTATTCATTTGGAATGATATGAACGAG CCTTCGATTTTCGATGGCCCAGAGACCACAGCTCCAAAAGATTTGATTCACGACAATTAC ATTGAGGAAAGATCCGTCCATAACATATATGGTCTATCAGTGCATGAAGCTACTTACGAC GCAATAAAATCGATTTATTCACCATCCGATAAGCGTCCTTTCCTTCTAACAAGGGCTTTT TTTGCCGGCTCTCAACGTACTGCTGCCACATGGACTGGTGACAATGTGGCCAATTGGGAT TACTTAAAGATTTCCATTCCTATGGTTCTGTCAAACAACATTGCTGGTATGCCATTTATA GGAGCCGACATAGCTGGCTTTGCTGAGGATCCTACACCTGAATTGATTGCACGTTGGTAC CAAGCGGGCTTATGGTACCCATTTTTTAGAGCACACGCCCATATAGACACCAAGAGAAGA GAACCATACTTATTCAATGAACCTTTGAAGTCGATAGTACGTGATATTATCCAATTGAGA TATTTCCTGCTACCTACCTTATACACCATGTTTCATAAATCAAGTGTCACTGGATTTCCG ATAATGAATCCAATGTTTATTGAACACCCTGAATTTGCTGAATTGTATCATATCGATAAC CAATTTTACTGGAGTAATTCAGGTCTATTAGTCAAACCTGTCACGGAGCCTGGTCAATCA GAAACGGAAATGGTTTTCCCACCCGGTATATTCTATGAATTCGCATCTTTACACTCTTTT ATAAACAATGGTACTGATTTGATAGAAAAGAATATTTCTGCACCATTGGATAAAATTCCA TTATTTATTGAAGGCGGTCACATTATCACTATGAAAGATAAGTATAGAAGATCTTCAATG TTAATGAAAAACGATCCATATGTAATAGTTATAGCCCCTGATACCGAGGGACGAGCCGTT GGAGATCTTTATGTTGATGATGGAGAAACTTTTGGCTACCAAAGAGGTGAGTACGTAGAA ACTCAGTTCATTTTCGAAAACAATACCTTAAAAAATGTTCGAAGTCATATTCCCGAGAAT TTGACAGGCATTCACCACAATACTTTGAGGAATACCAATATTGAAAAAATCATTATCGCA AAGAATAATTTACAACACAACATAACGTTGAAAGACAGTATTAAAGTCAAAAAAAATGGC GAAGAAAGTTCATTGCCGACTAGATCGTCATATGAGAATGATAATAAGATCACCATTCTT AACCTATCGCTTGACATAACTGAAGATTGGGAAGTTATTTTTTGA
Protein Properties
Pfam Domain Function
Protein Residues954
Protein Molecular Weight110265.0
Protein Theoretical pI6.1
Signalling Regions
  • 1-22
Transmembrane Regions
  • None
Protein Sequence>Glucosidase 2 subunit alpha MVLLKWLVCQLVFFTAFSHAFTDYLLKKCAQSGFCHRNRVYAENIAKSHHCYYKVDAESI AHDPLENVLHATIIKTIPRLEGDDIAVQFPFSLSFLQDHSVRFTINEKERMPTNSSGLLI SSQRFNETWKYAFDKKFQEEANRTSIPQFHFLKQKQTVNSFWSKISSFLSLSNSTADTFH LRNGDVSVEIFAEPFQLKVYWQNALKLIVNEQNFLNIEHHRTKQENFAHVLPEETTFNMF KDNFLYSKHDSMPLGPESVALDFSFMGSTNVYGIPEHATSLRLMDTSGGKEPYRLFNVDV FEYNIGTSQPMYGSIPFMFSSSSTSIFWVNAADTWVDIKYDTSKNKTMTHWISENGVIDV VMSLGPDIPTIIDKFTDLTGRPFLPPISSIGYHQCRWNYNDEMDVLTVDSQMDAHMIPYD FIWLDLEYTNDKKYFTWKQHSFPNPKRLLSKLKKLGRNLVVLIDPHLKKDYEISDRVINE NVAVKDHNGNDYVGHCWPGNSIWIDTISKYGQKIWKSFFERFMDLPADLTNLFIWNDMNE PSIFDGPETTAPKDLIHDNYIEERSVHNIYGLSVHEATYDAIKSIYSPSDKRPFLLTRAF FAGSQRTAATWTGDNVANWDYLKISIPMVLSNNIAGMPFIGADIAGFAEDPTPELIARWY QAGLWYPFFRAHAHIDTKRREPYLFNEPLKSIVRDIIQLRYFLLPTLYTMFHKSSVTGFP IMNPMFIEHPEFAELYHIDNQFYWSNSGLLVKPVTEPGQSETEMVFPPGIFYEFASLHSF INNGTDLIEKNISAPLDKIPLFIEGGHIITMKDKYRRSSMLMKNDPYVIVIAPDTEGRAV GDLYVDDGETFGYQRGEYVETQFIFENNTLKNVRSHIPENLTGIHHNTLRNTNIEKIIIA KNNLQHNITLKDSIKVKKNGEESSLPTRSSYENDNKITILNLSLDITEDWEVIF
References
External Links
ResourceLink
Saccharomyces Genome Database ROT2
Uniprot IDP38138
Uniprot NameGLU2A_YEAST
GenBank Gene IDZ36098
Genebank Protein ID536626
General Reference
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Saunier, B., Kilker, R. D. Jr, Tkacz, J. S., Quaroni, A., Herscovics, A. (1982). "Inhibition of N-linked complex oligosaccharide formation by 1-deoxynojirimycin, an inhibitor of processing glucosidases." J Biol Chem 257:14155-14161.6216253
  • Trombetta, E. S., Simons, J. F., Helenius, A. (1996). "Endoplasmic reticulum glucosidase II is composed of a catalytic subunit, conserved from yeast to mammals, and a tightly bound noncatalytic HDEL-containing subunit." J Biol Chem 271:27509-27516.8910335
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Wilkinson, B. M., Purswani, J., Stirling, C. J. (2006). "Yeast GTB1 encodes a subunit of glucosidase II required for glycoprotein processing in the endoplasmic reticulum." J Biol Chem 281:6325-6333.16373354