You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable mannosyltransferase KTR3
SynonymsNot Available
Gene NameKTR3
Enzyme Class
Biological Properties
General FunctionInvolved in mannosyltransferase activity
Specific FunctionPossible glycosyltransferase
Cellular LocationMembrane; Single-pass type II membrane protein (Probable)
SMPDB Pathways
N-Glycan biosynthesisPW002501 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
N-Glycan biosynthesisec00510 Map00510
SMPDB ReactionsNot Available
KEGG Reactions
Beta-1,4-D-Mannosylchitobiosyldiphosphodolichol + Guanosine diphosphate mannosealpha-D-mannosyl-beta-D-mannosyldiacetylchitobiosyldiphosphodolichol + hydron + Guanosine diphosphate
Metabolites
YMDB IDNameView
YMDB00202Guanosine diphosphate mannoseShow
YMDB00257Guanosine diphosphateShow
YMDB00581alpha-D-mannosyl-beta-D-mannosyldiacetylchitobiosyldiphosphodolicholShow
YMDB00862hydronShow
YMDB00935beta-D-mannosyldiacetylchitobiosyldiphosphodolicholShow
GO Classification
Component
cell part
membrane
Function
alpha-1,2-mannosyltransferase activity
glycolipid 2-alpha-mannosyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring hexosyl groups
mannosyltransferase activity
Process
protein modification process
protein amino acid glycosylation
metabolic process
macromolecule metabolic process
macromolecule modification
Gene Properties
Chromosome Locationchromosome 2
LocusYBR205W
Gene Sequence>1215 bp ATGTCTGTGCACCACAAAAAGAAGCTAATGCCCAAATCGGCATTGCTGATTAGAAAATAC CAAAAGGGAATCAGATCATCATTCATTGGGCTCATCATAGTGTTATCCTTTTTATTTTTC ATGAGTGGCTCAAGGTCCCCAGAGGTACCAATAGCTCAGGGCACCAGTGTCAGTCGTGTA GCCAGTAAGGATTATTTGATGCCGTTTACTGACAAGTCACAAGGAGTAATCCATCCCGTG GACGATGGAAAGAAGGAAAAGGGTGTTATGGTCACATTGGCCAGGAATTCAGATTTATGG AACTTGGTAAAATCTATTAGACATGTTGAAGACAGGTTCAATAACAGATATCACTACGAT TGGGTGTTCTTGAATGACCAACCATTTAGTGATGAGTTTAAACGTGTTACCAGTGCATTG GTTTCAGGCAAGGCAAAATATGGGACAATCCCAAAGGACCATTGGTCCATTCCATCTTGG ATCGATACTGAAAAATTCGATGAGAAAAGGCTTGCAATGGGAAAATTGGATATTCCATAT GGTAGTTCCGTGCCTTACCGTCACATGTGCCGTTTCCAGTCAGGGTTCATATGGAGACAC CCACTACTGGAGGAGTACGAATGGTTTTGGAGAGTGGATACCGATATCACTTTATTCTGT GATATTCAGTATGACATATTCAAGTTTTTAAAAGTAAATAACAAGAAATATGGATTCATT CTTTCGGTAAGTGAATATGAGCGCACAATCCCAACCTTGTGGGAAACGACAAAGAAATTC ATCAAGAAAAATCCTAAATTCTTACACAAAAATAACCTCATGAAATTCATTTCGAATGAT GATGGTGACACTTATAATATGTGTCATTTCTGGACCAACTTCGAAATCGGCTCTTTAGAC TTCTTCAGGTCCGATGCATACAGAGAATACTTTGATTACTTAGACAGTTCTGGTGGATTC TTCTACGAAAGATGGGGGGATGCGCCAGTGCACTCCATCGCTGCCTCTTTGTTCTTGGAC AAGTCAGAAATCCATTTCTTTGACGGTCTTGGATTCCATCATCCAGATTTCACCTCTTGT CCTATCGAACAGAAGATTAGACTACAAAACAAGTGTATCTGCGAACCTAGCAAGGACGTC ACCTGGACTCCTGACTACTTCTGTACTAGAAAGTACTTTTCAGCAGGAAATTACAAGCTT CCACCAGGAATTTAA
Protein Properties
Pfam Domain Function
Protein Residues404
Protein Molecular Weight47482.0
Protein Theoretical pI9.01
Signalling Regions
  • None
Transmembrane Regions
  • 28-44
Protein Sequence>Probable mannosyltransferase KTR3 MSVHHKKKLMPKSALLIRKYQKGIRSSFIGLIIVLSFLFFMSGSRSPEVPIAQGTSVSRV ASKDYLMPFTDKSQGVIHPVDDGKKEKGVMVTLARNSDLWNLVKSIRHVEDRFNNRYHYD WVFLNDQPFSDEFKRVTSALVSGKAKYGTIPKDHWSIPSWIDTEKFDEKRLAMGKLDIPY GSSVPYRHMCRFQSGFIWRHPLLEEYEWFWRVDTDITLFCDIQYDIFKFLKVNNKKYGFI LSVSEYERTIPTLWETTKKFIKKNPKFLHKNNLMKFISNDDGDTYNMCHFWTNFEIGSLD FFRSDAYREYFDYLDSSGGFFYERWGDAPVHSIAASLFLDKSEIHFFDGLGFHHPDFTSC PIEQKIRLQNKCICEPSKDVTWTPDYFCTRKYFSAGNYKLPPGI
References
External Links
ResourceLink
Saccharomyces Genome Database KTR3
Uniprot IDP38130
Uniprot NameKTR3_YEAST
GenBank Gene IDZ21487
Genebank Protein ID311682
General Reference
  • Bussereau, F., Mallet, L., Gaillon, L., Jacquet, M. (1993). "A 12.8 kb segment, on the right arm of chromosome II from Saccharomyces cerevisiae including part of the DUR1,2 gene, contains five putative new genes." Yeast 9:797-806.8368014
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Inadome, H., Noda, Y., Adachi, H., Yoda, K. (2005). "Immunoisolaton of the yeast Golgi subcompartments and characterization of a novel membrane protein, Svp26, discovered in the Sed5-containing compartments." Mol Cell Biol 25:7696-7710.16107716