You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMitochondrial carrier protein RIM2
SynonymsNot Available
Gene NameRIM2
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in binding
Specific FunctionNot Available
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00049Uridine 5'-monophosphateShow
YMDB00279Cytidine triphosphateShow
YMDB00326Uridine triphosphateShow
YMDB00406Cytidine monophosphateShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
organelle membrane
organelle inner membrane
mitochondrial inner membrane
Function
binding
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 2
LocusYBR192W
Gene Sequence>1134 bp ATGCCAAAAAAATCCATTGAAGAATGGGAAGAGGATGCCATTGAATCAGTTCCATATTTA GCAAGTGATGAAAAGGGCTCTAATTATAAGGAAGCTACACAAATTCCACTAAATTTGAAG CAATCTGAAATTGAAAATCATCCAACAGTAAAACCATGGGTTCATTTTGTTGCTGGGGGT ATTGGAGGAATGGCGGGTGCAGTTGTTACGTGTCCCTTTGATTTGGTGAAGACCCGATTA CAAAGTGATATATTTTTGAAAGCATACAAATCACAAGCTGTTAATATCAGTAAAGGATCT ACTCGTCCAAAGAGTATTAATTATGTCATTCAAGCAGGAACCCATTTCAAGGAAACACTG GGAATCATAGGCAATGTGTACAAACAAGAGGGTTTTAGAAGCTTGTTTAAGGGTTTGGGC CCCAATTTAGTCGGGGTTATTCCAGCAAGAAGTATTAATTTTTTTACCTATGGAACTACT AAAGATATGTATGCTAAAGCGTTCAATAATGGCCAAGAAACACCTATGATTCATCTGATG GCTGCTGCAACCGCAGGTTGGGCAACGGCGACGGCAACCAATCCTATTTGGTTGATTAAA ACAAGAGTACAGCTTGATAAAGCTGGGAAAACATCGGTCCGACAGTACAAGAACTCTTGG GATTGCTTAAAAAGTGTTATAAGAAATGAGGGTTTCACTGGCTTGTACAAAGGGTTGAGT GCCTCTTATTTGGGTTCTGTTGAAGGTATACTTCAATGGCTATTATATGAACAAATGAAG AGGTTAATAAAGGAAAGGTCTATTGAGAAATTTGGATATCAAGCCGAAGGTACAAAAAGC ACATCAGAGAAAGTCAAGGAGTGGTGTCAAAGATCAGGAAGCGCTGGTCTTGCAAAATTT GTGGCTAGTATAGCAACATATCCGCACGAAGTTGTCAGGACGAGATTGAGACAGACGCCC AAGGAAAATGGTAAACGAAAGTATACAGGTTTAGTACAAAGTTTCAAAGTTATAATTAAA GAAGAGGGACTCTTTTCAATGTATAGTGGGTTGACCCCGCATTTGATGAGAACAGTTCCG AACAGTATAATTATGTTTGGTACATGGGAAATTGTTATAAGGCTACTATCGTAG
Protein Properties
Pfam Domain Function
Protein Residues377
Protein Molecular Weight42101.39844
Protein Theoretical pI10.14
Signalling Regions
  • None
Transmembrane Regions
  • 53-73
  • 131-151
  • 179-199
  • 238-258
  • 286-306
  • 347-368
Protein Sequence>Mitochondrial carrier protein RIM2 MPKKSIEEWEEDAIESVPYLASDEKGSNYKEATQIPLNLKQSEIENHPTVKPWVHFVAGG IGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETL GIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPMIHLM AAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLS ASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKF VASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVP NSIIMFGTWEIVIRLLS
References
External Links
ResourceLink
Saccharomyces Genome Database RIM2
Uniprot IDP38127
Uniprot NameRIM2_YEAST
GenBank Gene IDAY557871
Genebank Protein ID45269633
General Reference
  • Demolis, N., Mallet, L., Bussereau, F., Jacquet, M. (1993). "RIM2, MSI1 and PGI1 are located within an 8 kb segment of Saccharomyces cerevisiae chromosome II, which also contains the putative ribosomal gene L21 and a new putative essential gene with a leucine zipper motif." Yeast 9:645-659.8346681
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287