You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name3-methyl-2-oxobutanoate hydroxymethyltransferase
Synonyms
  • Extracellular matrix protein 31
  • Ketopantoate hydroxymethyltransferase
Gene NameECM31
Enzyme Class
Biological Properties
General FunctionInvolved in 3-methyl-2-oxobutanoate hydroxymethyltransferase activity
Specific Function5,10-methylenetetrahydrofolate + 3-methyl-2- oxobutanoate + H(2)O = tetrahydrofolate + 2-dehydropantoate
Cellular LocationNot Available
SMPDB Pathways
Pantothenate and CoA biosynthesisPW002463 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pantothenate and CoA biosynthesisec00770 Map00770
SMPDB Reactions
Alpha-Ketoisovaleric acid + 5,10-Methylene-THF + waterTetrahydrofolic acid + 2-Dehydropantoate
KEGG Reactions
Alpha-Ketoisovaleric acid + water + 5,10-Methylene-THF2-Dehydropantoic acid + 5,6,7,8-Tetrahydrofolic acid
Metabolites
YMDB IDNameView
YMDB000932-Dehydropantoic acidShow
YMDB00139Tetrahydrofolic acidShow
YMDB002605,10-Methylene-THFShow
YMDB00365Alpha-Ketoisovaleric acidShow
YMDB004835,6,7,8-Tetrahydrofolic acidShow
YMDB00848(6R)-5,10-methylenetetrahydrofolic acidShow
YMDB00890waterShow
YMDB010582-DehydropantoateShow
GO Classification
Component
Not Available
Function
3-methyl-2-oxobutanoate hydroxymethyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
glycine hydroxymethyltransferase activity
hydroxymethyl-, formyl- and related transferase activity
Process
metabolic process
cellular metabolic process
cofactor metabolic process
coenzyme metabolic process
coenzyme biosynthetic process
pantothenate biosynthetic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR176W
Gene Sequence>939 bp ATGAATATAATGAAAAGACAATTATGCACCTCCTCTAAGCGATTTTTTTCTACAGCAAAA AACGTTGTCAAATATAATACGATTCAGGATATCAGGAACAAATATTTTACTGGTACGCCT TTGTCGATGTGTACTGCGTATGACTTCATTACTGCAACATGGGTTAACAAGGCTAATTGT GATTTACTCTTAGTCGGAGATTCTTTGGCGATGACTTCATTGGGGTACGATAGCACAATT ACACTATCCTTGAATGAGTTTAAATATCATGTTGCCTCTGTGTGCAGAGCTGAAGGTTCT TCCATGGTAGTGGTAGACATGCCATTCGGTACGTTTGAATCGGGCATATCTGATGGCTTG AAGAATGCCATAGATATCATGAAATTGGACAGTAAAGTCACCTCAGTCAAAGTTGAAGTC GGTTCTTACACCAAAGACAAATATGCAATGAAATTTATTGAAGAACTGTGCTCCCGGGGT ATACCTGTTATGGCTCATATAGGACTAACTCCCCAAAAAGTTCATTCACTTGGAGGTTAT AAAGTGCAAGGTAGCAAAAGTCTATTACAAATGCAGGAGCTGTATGAAACCGCCATGCAA CTACAAAAAATTGGCTGTTGGTCTATCCTGATTGAATGTGTCCCCCATAAGATGGCTCAG TTCATAACATCTAAACTCTCAGTACCAACAATAGGTATCGGTGCAGGTAACGGTACCAGT GGACAAGTTCTAGTTATATCTGACCTTCTCGGGATGCAAGGCGATTCTGTCCCAAAATTT GTGAAGCAAGCTGTAAATATGACAGATATTGCCACTCAGGGCTTGAAGGAGTACATTGCA AGTGTAGAGGATAGGACATTTCCTGAGAGAGGTACTCATACTTTCAAAGTTAAGGAGGAC TTATGGAATGAATTCCTCTCTTCAATTAACGAAAAGTAA
Protein Properties
Pfam Domain Function
Protein Residues312
Protein Molecular Weight34464.69922
Protein Theoretical pI8.26
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>3-methyl-2-oxobutanoate hydroxymethyltransferase MNIMKRQLCTSSKRFFSTAKNVVKYNTIQDIRNKYFTGTPLSMCTAYDFITATWVNKANC DLLLVGDSLAMTSLGYDSTITLSLNEFKYHVASVCRAEGSSMVVVDMPFGTFESGISDGL KNAIDIMKLDSKVTSVKVEVGSYTKDKYAMKFIEELCSRGIPVMAHIGLTPQKVHSLGGY KVQGSKSLLQMQELYETAMQLQKIGCWSILIECVPHKMAQFITSKLSVPTIGIGAGNGTS GQVLVISDLLGMQGDSVPKFVKQAVNMTDIATQGLKEYIASVEDRTFPERGTHTFKVKED LWNEFLSSINEK
References
External Links
ResourceLink
Saccharomyces Genome Database ECM31
Uniprot IDP38122
Uniprot NamePANB_YEAST
GenBank Gene IDZ36045
Genebank Protein ID536525
General Reference
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • White, W. H., Gunyuzlu, P. L., Toyn, J. H. (2001). "Saccharomyces cerevisiae is capable of de Novo pantothenic acid biosynthesis involving a novel pathway of beta-alanine production from spermine." J Biol Chem 276:10794-10800.11154694
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106