You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameValine/tyrosine/tryptophan amino-acid permease 1
Synonyms
  • Tyrosine and tryptophan amino acid transporter 1
Gene NameTAT1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionHigh-affinity transport of valine and tyrosine. Low- affinity transport of tryptophan. Can also transport L-cysteine
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00038L-IsoleucineShow
YMDB00046L-CysteineShow
YMDB00126L-TryptophanShow
YMDB00152L-ValineShow
YMDB00214L-ThreonineShow
YMDB00364L-TyrosineShow
YMDB00369L-HistidineShow
YMDB00387L-LeucineShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
amine transmembrane transporter activity
amino acid transmembrane transporter activity
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 2
LocusYBR069C
Gene Sequence>1860 bp ATGGACGATAGTGTCAGTTTCATTGCCAAAGAGGCCAGTCCAGCACAATATTCGCACAGT TTGCATGAAAGAACACACAGTGAAAAACAAAAGAGAGACTTTACAATAACAGAAAAACAA GATGAGGTATCTGGACAAACAGCGGAGCCTCGAAGGACGGACAGCAAATCCATATTACAG AGGAAATGCAAAGAATTCTTCGACTCTTTTAAAAGGCAGCTGCCACCAGACCGTAATTCC GAACTAGAGTCCCAAGAAAAAAACAACCTGACAAAGTCGATCAAATCTCGTCACTTAGTC ATGATCAGTCTCGGTACCGGTATAGGTACTGGTTTACTGGTCGGTAATGGTCAGGTGCTG GGAACAGCTGGTCCTGCCGGGTTAGTCCTTGGTTACGGAATAGCATCGATCATGCTTTAC TGTATCATCCAAGCGGCAGGCGAGTTAGGTCTCTGTTATGCAGGACTAACCGGCAATTAC ACCAGATATCCTTCTATTTTAGTCGACCCTTCGTTGGGTTTTGCAGTTTCTGTGGTTTAC ACCATTCAATGGCTAACTGTTCTGCCCTTACAATTGGTCACTGCGGCAATGACAGTTAAG TACTGGACGAGTGTAAATGCAGACATCTTTGTTGCCGTGGTTTTCGTTTTTGTAATTATC ATTAATCTATTTGGGTCCAGAGGCTATGCTGAAGCCGAGTTCATTTTCAATTCCTGTAAG ATATTGATGGTAATCGGATTCGTCATTCTGGCGATTATCATCAATTGTGGGGGTGCAGGT GACAGAAGATACATCGGTGCTGAGTACTGGCACAATCCTGGTCCATTTGCCCACGGTTTC AAAGGTGTATGTACGGTTTTCTGTTATGCTGCATTCAGCTACGGTGGAATTGAAGTTCTA CTTCTATCTGCCGCTGAGCAGGAAAACCCAACAAAATCTATTCCCAATGCCTGCAAAAAA GTGGTATACCGTATTCTGCTGATTTACATGCTCACCACCATTTTGGTTTGCTTTCTTGTT CCATACAACAGTGACGAATTATTAGGGTCTAGTGACTCCTCTGGATCCCATGCCTCCCCA TTTGTCATTGCTGTTGCATCACATGGTGTCAAAGTTGTGCCTCACTTTATAAATGCTGTT ATTTTGATTTCTGTCATTTCTGTTGCAAACTCTTCGTTATATTCTGGGCCAAGATTGTTA TTATCATTGGCAGAACAAGGCGTCTTACCTAAATGCTTAGCATATGTTGATAGAAACGGC AGGCCTTTACTTTGTTTTTTTGTTTCCCTTGTCTTTGGATGCATTGGGTTTGTAGCCACT AGTGACGCTGAAGAACAGGTTTTCACCTGGTTATTGGCAATTTCTAGTCTTTCGCAATTA TTTATCTGGATGTCAATGTCCTTGTCACATATAAGATTTAGAGATGCCATGGCAAAGCAA GGTCGTTCGATGAACGAAGTTGGATACAAAGCACAAACTGGCTATTGGGGTTCATGGCTT GCAGTTTTAATTGCAATCTTCTTCCTTGTGTGCCAGTTCTGGGTAGCCATCGCACCTGTT AATGAACATGGAAAACTTAACGTCAAAGTGTTTTTCCAAAATTATTTGGCAATGCCCATC GTTTTGTTTGCCTATTTTGGTCACAAGATATACTTCAAATCATGGAGCTTTTGGATTCCA GCCGAAAAAATTGATTTGGACTCACATAGAAACATATTTGTGTCTCCATCGCTTACAGAG ATCGACAAAGTTGACGATAACGATGATCTTAAAGAGTATGAAAATTCAGAATCGTCGGAA AATCCAAACAGTTCGCGTTCAAGAAAGTTTTTTAAGAGGATGACCAATTTCTGGTGCTAA
Protein Properties
Pfam Domain Function
Protein Residues619
Protein Molecular Weight68756.89844
Protein Theoretical pI7.8
Signalling Regions
  • None
Transmembrane Regions
  • 100-120
  • 123-143
  • 173-193
  • 205-225
  • 234-254
  • 282-302
  • 321-341
  • 369-389
  • 423-443
  • 447-467
  • 500-520
  • 530-550
Protein Sequence>Valine/tyrosine/tryptophan amino-acid permease 1 MDDSVSFIAKEASPAQYSHSLHERTHSEKQKRDFTITEKQDEVSGQTAEPRRTDSKSILQ RKCKEFFDSFKRQLPPDRNSELESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVL GTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVY TIQWLTVLPLQLVTAAMTVKYWTSVNADIFVAVVFVFVIIINLFGSRGYAEAEFIFNSCK ILMVIGFVILAIIINCGGAGDRRYIGAEYWHNPGPFAHGFKGVCTVFCYAAFSYGGIEVL LLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSSDSSGSHASP FVIAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNG RPLLCFFVSLVFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQ GRSMNEVGYKAQTGYWGSWLAVLIAIFFLVCQFWVAIAPVNEHGKLNVKVFFQNYLAMPI VLFAYFGHKIYFKSWSFWIPAEKIDLDSHRNIFVSPSLTEIDKVDDNDDLKEYENSESSE NPNSSRSRKFFKRMTNFWC
References
External Links
ResourceLink
Saccharomyces Genome Database TAT1
Uniprot IDP38085
Uniprot NameTAT1_YEAST
GenBank Gene IDU10503
Genebank Protein ID558077
General Reference
  • Schmidt, A., Hall, M. N., Koller, A. (1994). "Two FK506 resistance-conferring genes in Saccharomyces cerevisiae, TAT1 and TAT2, encode amino acid permeases mediating tyrosine and tryptophan uptake." Mol Cell Biol 14:6597-6606.7523855
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Van der Aart, Q. J., Barthe, C., Doignon, F., Aigle, M., Crouzet, M., Steensma, H. Y. (1994). "Sequence analysis of a 31 kb DNA fragment from the right arm of Saccharomyces cerevisiae chromosome II." Yeast 10:959-964.7985423
  • During-Olsen, L., Regenberg, B., Gjermansen, C., Kielland-Brandt, M. C., Hansen, J. (1999). "Cysteine uptake by Saccharomyces cerevisiae is accomplished by multiple permeases." Curr Genet 35:609-617.10467005
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Hitchcock, A. L., Auld, K., Gygi, S. P., Silver, P. A. (2003). "A subset of membrane-associated proteins is ubiquitinated in response to mutations in the endoplasmic reticulum degradation machinery." Proc Natl Acad Sci U S A 100:12735-12740.14557538
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956