You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLeu/Val/Ile amino-acid permease
Synonyms
  • Branched-chain amino-acid permease 2
Gene NameBAP2
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionPermease for leucine, valine and isoleucine. Also transports cysteine, methionine, phenyalanine, tyrosine and tryptophan
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00038L-IsoleucineShow
YMDB00046L-CysteineShow
YMDB00126L-TryptophanShow
YMDB00152L-ValineShow
YMDB00154L-AlanineShow
YMDB00304L-PhenylalanineShow
YMDB00318L-MethionineShow
YMDB00364L-TyrosineShow
YMDB00387L-LeucineShow
YMDB00862hydronShow
GO Classification
Component
membrane part
intrinsic to membrane
integral to membrane
cell part
membrane
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 2
LocusYBR068C
Gene Sequence>1830 bp ATGCTATCTTCAGAAGATTTTGGATCTTCTGGGAAAAAGGAAACTTCTCCTGATTCGATA TCGATACGTTCCTTTAGTGCCGGGAATAATTTCCAATCATCATCAAGTGAGAAAACTTAT TCTAAGCAAAAATCCGGGAGTGACAAACTTATACATAGATTTGCGGATTCATTCAAAAGA GCCGAGGGTAGCACTACAAGAACTAAGCAAATAAATGAAAATACGTCTGATTTAGAGGAT GGCGTTGAGTCTATCACGTCGGATTCCAAGTTGAAAAAGTCCATGAAGTCGCGCCATGTT GTCATGATGTCTTTAGGGACAGGTATTGGGACTGGTCTTTTGGTAGCTAATGCAAAAGGT CTACATTACGGTGGTCCTGCTGCGCTAATAATTGGTTACATCTTGGTTTCTTTCGAGACG TACTTCATGATCCAAGCTGCAGGTGAGATGGCGGTAACCTATCCGACTTTACCAGCAAAT TTCAACGCATACTCCTCCATATTCATTTCCAAATCATTTGGATTCGCCACAGTATGGCTT TACTGTTTCCAATGGCTAACGGTTTTGCCTTTAGAGTTAATAACCGCGTCTATGACTATT CAATTTGGGAATGATAAAATAAATCCGGACATTTATATTCTTATTTTCTATGTTTTCTTA GTATTCATTCATTTCTTCGGTGTAAAAGCCTATGGTGAAACGGAATTCATCTTCAATTGC TGTAAAATTTTAATGATTGCAGGTTTCATTATTCTTTCTATTGTTATCAACTGTGGTGGG GCCGGAAATGACGGTTATATCGGGGCCACTTATTGGCATAATCCAGGTGCTTTTGCAGGT GACACATCGATTGGTAGGTTCAAAAACGTTTGCTATATTTTAGTTACTGCTTACTTCTCC TTTGGTGGTATGGAATTATTTGCACTAAGTGTTCAGGAACAGTCTAACCCTAGAAAATCT ACTCCGGTGGCAGCCAAGAGAAGCATTTATCGTATCGTTGTGATTTATCTTTTGACTATG ATCCTCATTGGATTCAATGTTCCATATAATGATGACCAACTAATGGGCGCAGGCGGATCC GCTACACATGCATCTCCCTATGTCTTAGCCGCTTCTATTCACGGTGTGAAAATTGTTCCA CATATTATCAACGCTGTTATTTTGATTTCTGTGGTTTCAGTGGCAAATTCCTCTTTGTAT GCTGGTCCAAGACTGATTTGCTCTTTGGCCCAACAAGGCTACGCACCCAAGTTTTTAGAT TACGTTGACAGAGAGGGCAGGCCCTTGAGAGCTCTTATTGTGTGTTGCGTTTTCGGCGTC ATTGCTTTTGTTGCAGCTTCATCAAAGGAAGAGATCGTGTTTACATGGTTAGCAGCTATC GCAGGCTTGAGTGAATTATTCACATGGACTTCCATAATGTTGTCCCATCTGCGATTCAGA CAAGCAATGAAAGTACAGGGAAGGTCTCTAGACGAGTTGGGATACAAGGCCACAACAGGG ATTTGGGGTTCCATATACGGTGTCTTTTTTAATATTTTAGTCTTTGTTGCCCAATTTTGG GTAGCATTGGCCCCCTTAGGTAATGGGGGCAAATGCGATGCGGAATCCTTCTTTCAAAAT TATTTAGCTTTTCCAATATGGTTGGCCTTTTACTTCGGATATATGGTTTACAACCGAGAT TTTACGCTATTAAATCCCCTCGACAAGATTGACCTTGACTTCCACAGACGCATTTATGAT CCAGAGCTAATGAGACAAGAGGACGAAGAAAATAAAGAAAAACTAAGGAATATGTCTTTG ATGAGAAAAGCTTATCATTTCTGGTGTTAA
Protein Properties
Pfam Domain Function
Protein Residues609
Protein Molecular Weight67669.60156
Protein Theoretical pI8.22
Signalling Regions
  • None
Transmembrane Regions
  • 100-120
  • 124-144
  • 174-194
  • 211-231
  • 236-256
  • 290-310
  • 329-349
  • 375-395
  • 428-448
  • 452-472
  • 501-521
  • 537-557
Protein Sequence>Leu/Val/Ile amino-acid permease MLSSEDFGSSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKR AEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKG LHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWL YCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNC CKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFS FGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGS ATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLD YVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFR QAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQN YLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNMSL MRKAYHFWC
References
External Links
ResourceLink
Saccharomyces Genome Database BAP2
Uniprot IDP38084
Uniprot NameBAP2_YEAST
GenBank Gene IDZ35937
Genebank Protein ID536316
General Reference
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Grauslund, M., Didion, T., Kielland-Brandt, M. C., Andersen, H. A. (1995). "BAP2, a gene encoding a permease for branched-chain amino acids in Saccharomyces cerevisiae." Biochim Biophys Acta 1269:275-280.7495881
  • During-Olsen, L., Regenberg, B., Gjermansen, C., Kielland-Brandt, M. C., Hansen, J. (1999). "Cysteine uptake by Saccharomyces cerevisiae is accomplished by multiple permeases." Curr Genet 35:609-617.10467005
  • Regenberg, B., During-Olsen, L., Kielland-Brandt, M. C., Holmberg, S. (1999). "Substrate specificity and gene expression of the amino-acid permeases in Saccharomyces cerevisiae." Curr Genet 36:317-328.10654085
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956