Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHNRNP arginine N-methyltransferase
Synonyms
  • Protein ODP1
Gene NameHMT1
Enzyme Class
Biological Properties
General FunctionInvolved in protein methyltransferase activity
Specific FunctionMethylates arginines in a variety of RNA-binding proteins. Methylates NOP3. Can catalyze both the mono- and asymmetric dimethylation
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
L-Histidine + S-AdenosylmethionineS-Adenosylhomocysteine + N(pros)-methyl-L-histidine + hydron
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00369L-HistidineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB00703N(pros)-methyl-L-histidineShow
YMDB00862hydronShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
transferase activity, transferring one-carbon groups
methyltransferase activity
catalytic activity
transferase activity
protein methyltransferase activity
Process
metabolic process
protein amino acid alkylation
macromolecule metabolic process
protein amino acid methylation
macromolecule modification
protein modification process
post-translational protein modification
Gene Properties
Chromosome Locationchromosome 2
LocusYBR034C
Gene Sequence>1047 bp ATGAGCAAGACAGCCGTGAAAGATTCTGCTACAGAAAAAACCAAGCTAAGTGAAAGCGAA CAGCACTACTTCAATTCGTACGATCACTATGGTATTCACGAAGAGATGCTTCAAGATACT GTTCGTACCTTATCTTACAGAAACGCAATTATCCAAAATAAGGATCTTTTTAAGGACAAG ATTGTTTTAGACGTCGGTTGCGGTACCGGTATTTTATCCATGTTTGCCGCTAAACACGGT GCGAAGCATGTTATCGGTGTTGATATGTCAAGCATTATTGAGATGGCGAAGGAATTGGTA GAGTTGAACGGATTCAGCGACAAGATCACCTTGCTAAGAGGCAAGTTGGAGGACGTTCAT TTACCCTTTCCTAAAGTTGACATCATAATTTCTGAATGGATGGGTTACTTTCTACTATAC GAGTCCATGATGGACACCGTTCTTTACGCTAGAGACCACTATTTGGTAGAAGGCGGTCTG ATCTTTCCCGACAAGTGCTCCATTCATTTGGCCGGTTTGGAAGACTCTCAGTATAAAGAC GAGAAGTTGAACTACTGGCAAGACGTTTACGGGTTTGATTATTCGCCATTTGTTCCGTTG GTCTTACACGAGCCCATCGTCGACACCGTGGAAAGAAACAATGTCAACACCACCTCAGAC AAATTGATCGAATTTGATTTAAATACAGTAAAAATATCAGATCTAGCGTTTAAGAGTAAC TTTAAATTGACGGCCAAGAGACAAGATATGATTAATGGTATAGTCACCTGGTTCGACATT GTTTTCCCTGCACCAAAGGGTAAGAGACCTGTTGAGTTCTCCACTGGTCCTCATGCTCCA TACACTCACTGGAAGCAAACAATATTTTATTTCCCTGATGATCTAGATGCTGAAACTGGT GACACCATTGAAGGTGAATTGGTTTGCTCTCCAAACGAGAAGAATAACAGAGATCTAAAT ATCAAAATTTCTTACAAGTTCGAATCGAATGGCATCGACGGTAATTCAAGAAGCAGAAAA AACGAAGGTTCTTATTTAATGCATTAA
Protein Properties
Pfam Domain Function
Protein Residues348
Protein Molecular Weight39785.80078
Protein Theoretical pI5.15
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>HNRNP arginine N-methyltransferase MSKTAVKDSATEKTKLSESEQHYFNSYDHYGIHEEMLQDTVRTLSYRNAIIQNKDLFKDK IVLDVGCGTGILSMFAAKHGAKHVIGVDMSSIIEMAKELVELNGFSDKITLLRGKLEDVH LPFPKVDIIISEWMGYFLLYESMMDTVLYARDHYLVEGGLIFPDKCSIHLAGLEDSQYKD EKLNYWQDVYGFDYSPFVPLVLHEPIVDTVERNNVNTTSDKLIEFDLNTVKISDLAFKSN FKLTAKRQDMINGIVTWFDIVFPAPKGKRPVEFSTGPHAPYTHWKQTIFYFPDDLDAETG DTIEGELVCSPNEKNNRDLNIKISYKFESNGIDGNSRSRKNEGSYLMH
References
External Links
ResourceLink
Saccharomyces Genome Database HMT1
Uniprot IDP38074
Uniprot NameHMT1_YEAST
GenBank Gene IDAY557869
Genebank Protein ID45269629
PDB ID
1G6Q
General Reference
  • Smits, P. H., De Haan, M., Maat, C., Grivell, L. A. (1994). "The complete sequence of a 33 kb fragment on the right arm of chromosome II from Saccharomyces cerevisiae reveals 16 open reading frames, including ten new open reading frames, five previously identified genes and a homologue of the SCO1 gene." Yeast 10 Suppl A:S75-S80.8091864
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Loubbardi, A., Marcireau, C., Karst, F., Guilloton, M. (1995). "Sterol uptake induced by an impairment of pyridoxal phosphate synthesis in Saccharomyces cerevisiae: cloning and sequencing of the PDX3 gene encoding pyridoxine (pyridoxamine) phosphate oxidase." J Bacteriol 177:1817-1823.7896706
  • Gary, J. D., Lin, W. J., Yang, M. C., Herschman, H. R., Clarke, S. (1996). "The predominant protein-arginine methyltransferase from Saccharomyces cerevisiae." J Biol Chem 271:12585-12594.8647869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Weiss, V. H., McBride, A. E., Soriano, M. A., Filman, D. J., Silver, P. A., Hogle, J. M. (2000). "The structure and oligomerization of the yeast arginine methyltransferase, Hmt1." Nat Struct Biol 7:1165-1171.11101900