You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGTP cyclohydrolase-2
Synonyms
  • GTP cyclohydrolase II
Gene NameRIB1
Enzyme Class
Biological Properties
General FunctionInvolved in GTP cyclohydrolase II activity
Specific FunctionCatalyzes the conversion of GTP to 2,5-diamino-6- ribosylamino-4(3H)-pyrimidinone 5'-phosphate (DARP), formate and pyrophosphate
Cellular LocationCytoplasmic
SMPDB Pathways
Riboflavin metabolismPW002443 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Riboflavin metabolismec00740 Map00740
SMPDB Reactions
GTP + waterFormic acid + Pyrophosphate + 2,5-Diamino-6-(1-D-ribosylamino)pyrimidin-4(3H)-one 5'-phosphate
KEGG Reactions
GTP + waterPyrophosphate + Formic acid + 2,5-Diamino-4-hydroxy-6-(5-phosphoribosylamino)pyrimidine + hydron
Metabolites
YMDB IDNameView
YMDB001472,5-Diamino-4-hydroxy-6-(5-phosphoribosylamino)pyrimidineShow
YMDB00219PyrophosphateShow
YMDB00385Formic acidShow
YMDB00558GTPShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB163092,5-Diamino-6-(1-D-ribosylamino)pyrimidin-4(3H)-one 5'-phosphate Show
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
cyclohydrolase activity
GTP cyclohydrolase activity
GTP cyclohydrolase II activity
catalytic activity
Process
metabolic process
nitrogen compound metabolic process
riboflavin metabolic process
riboflavin biosynthetic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBL033C
Gene Sequence>1038 bp ATGACCATAGATAACTACGACAACAGTAAACAGGATAGCAGCAAATACGAGGTTAGTGGT ACGGGTGATGGCAGGAACGGCGATGGCGGCTTGCCTCTAGTACAATGTGTCGCAAGAGCT CGTATCCCAACCACACAGGGTCCGGATATCTTTTTACATCTTTACAGTAACAACAGGGAC AACAAGGAACATCTAGCCATTGTGTTTGGTGAAGACATACGGTCGCGCTCGCTATTCCGT AGAAGACAGTGCGAGACGCAACAAGATAGAATGATCAGGGGCGCTTATATTGGCAAACTG TATCCCGGCAGAACTGTGGCAGACGAAGACGATAGACTCGGATTAGCTCTGGAGTTTGAT GATAGTACAGGTGAGTTATTAGCTTCCAAAGCCACTACATGGGACGCCCATAACGACACG CTGGTACGGATCCATTCTGAATGTTACACCGGTGAAAACGCATGGAGCGCCCGTTGTGAT TGTGGTGAACAATTCGATAGGGCCGGTAGGCTTATCGCTTGCGACCACGAACCCACAAGC AAGATCAAAGGTGGAAACGGCCATGGTGTTATCGTGTATCTAAGACAAGAGGGTCGTGGC ATCGGGTTAGGTGAGAAACTCAAGGCCTACAACCTGCAAGACTTAGGTGCTGACACAGTG CAGGCCAACTTAATGCTGAAACATCCCGTGGATGCTAGGGACTTCTCGCTGGGTAAGGCT ATTTTGCTGGATCTTGGCATCGGTAATGTCAGGCTGCTGACAAATAACCCGGAAAAGATA AAACAGGTAGATCATGCGCCTTACCTTAAGTGCGTTGAACGAGTGCCTATGGTACCCATA CACTGGACAAACTCCAGTGAAGGCATAGACTCCAAGGAGATAGAAGGTTATCTCAGGACC AAGATAGAAAGAATGGGTCATTTACTAACGGAGCCTCTGAAACTTCATACAAACCCTCAA CCTACTGAGACAAGTGAAGCCCAAAACCAAAACCGTATGAACTCTGCGTTGTCATCAACA TCGACGCTGGCAATATAA
Protein Properties
Pfam Domain Function
Protein Residues345
Protein Molecular Weight38331.60156
Protein Theoretical pI6.29
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>GTP cyclohydrolase-2 MTIDNYDNSKQDSSKYEVSGTGDGRNGDGGLPLVQCVARARIPTTQGPDIFLHLYSNNRD NKEHLAIVFGEDIRSRSLFRRRQCETQQDRMIRGAYIGKLYPGRTVADEDDRLGLALEFD DSTGELLASKATTWDAHNDTLVRIHSECYTGENAWSARCDCGEQFDRAGRLIACDHEPTS NIKGGNGHGVIVYLRQEGRGIGLGEKLKAYNLQDLGADTVQANLMLKHPVDARDFSLGKA ILLDLGIGNVRLLTNNPEKIKQVDHAPYLKCVERVPMVPIHWTNSSEGIDSKEIEGYLRT KIERMGHLLTEPLKLHTNPQPTETSEAQNQNRMNSALSSTSTLAI
References
External Links
ResourceLink
Saccharomyces Genome Database RIB1
Uniprot IDP38066
Uniprot NameRIB1_YEAST
GenBank Gene IDX74738
Genebank Protein ID511141
General Reference
  • Skala, J., Van Dyck, L., Purnelle, B., Goffeau, A. (1994). "The sequence of an 8.8 kb segment on the left arm of chromosome II from Saccharomyces cerevisiae reveals four new open reading frames including homologs of animal DNA polymerase alpha-primases and bacterial GTP cyclohydrolase II." Yeast 10 Suppl A:S13-S24.8091857
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956