You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameBifunctional purine biosynthesis protein ADE17
Synonyms
  • Phosphoribosylaminoimidazolecarboxamide formyltransferase
  • 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase
  • AICAR transformylase
  • IMP cyclohydrolase
  • ATIC
  • IMP synthase
  • Inosinicase
Gene NameADE17
Enzyme Class
Biological Properties
General FunctionInvolved in IMP cyclohydrolase activity
Specific Function10-formyltetrahydrofolate + 5-amino-1-(5- phospho-D-ribosyl)imidazole-4-carboxamide = tetrahydrofolate + 5- formamido-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide
Cellular LocationCytoplasmic
SMPDB Pathways
One Carbon Pool by Folate IPW002468 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB Reactions
Tetrahydrofolic acid + FAICARN10-Formyl-THF + 5-Amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide
KEGG Reactions
Inosinic acid + waterPhosphoribosyl formamidocarboxamide
5-Amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide + N10-Formyl-THF5,6,7,8-Tetrahydrofolic acid + Phosphoribosyl formamidocarboxamide
Metabolites
YMDB IDNameView
YMDB00080N10-Formyl-THFShow
YMDB00139Tetrahydrofolic acidShow
YMDB00281Phosphoribosyl formamidocarboxamideShow
YMDB00352Inosinic acidShow
YMDB004835,6,7,8-Tetrahydrofolic acidShow
YMDB0051710-Formyltetrahydrofolic acidShow
YMDB005625-Amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamideShow
YMDB00890waterShow
YMDB16256FAICARShow
GO Classification
Component
Not Available
Function
transferase activity
glycine hydroxymethyltransferase activity
hydroxymethyl-, formyl- and related transferase activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
phosphoribosylaminoimidazolecarboxamide formyltransferase activity
cyclohydrolase activity
IMP cyclohydrolase activity
transferase activity, transferring one-carbon groups
catalytic activity
methyltransferase activity
Process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside monophosphate biosynthetic process
purine ribonucleoside monophosphate biosynthetic process
IMP biosynthetic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR120C
Gene Sequence>1779 bp ATGGCCAATTACACAAAAACCGCAATCCTATCCGTCTATGACAAGACAGGTCTACTTGAT TTAGCCAGAGGCCTCATCGAGAAGAACGTTCGTATTCTCGCCTCCGGTGGTACTGCTCGT ATGATTCGTGACGCTGGTTTTCCAATCGAAGACGTTTCTGCTATCACACATGCCCCAGAA ATGTTGGGAGGTAGAGTGAAAACTTTACATCCTGCCGTTCATGGTGGTATCCTTGCTAGG GACATCGATAGCGATGAGAAAGACTTGAAGGAACAGCACATTGAAAAAGTCGATTATGTC GTTTGTAACCTATACCCATTCAAAGAAACTGTTGCTAAGGTGGGTGTGACTATTCCAGAA GCAGTAGAAGAAATTGATATTGGTGGTGTTACTCTATTAAGAGCAGCTGCTAAGAACCAT GCTAGAGTCACTATTTTATCTGATCCAAAGGACTACTCCGAATTTTTAAGTGAATTATCC AGTAATGGTGAAATCTCTCAAGATTTGAGAAACAGATTGGCATTAAAGGCTTTCGAACAC ACTGCCGATTATGATGCTGCAATTTCAGATTTCTTCAGGAAACAATACTCTGAAGGTCAA GCTCAAATTACTCTACGTTATGGTGCCAATCCACACCAAAAGCCGGCTCAAGCTTACGTC AGTCAACAAGACAGTTTACCTTTCAAAGTCCTATGTGGTTCACCAGGTTACATTAATTTG TTGGATGCTCTAAATTCCTGGCCCCTGGTTAAGGAATTATCCGCCTCGTTGAATTTACCA GCAGCAGCATCGTTCAAGCATGTATCACCAGCTGGTGCCGCTGTGGGTATCCCATTGTCT GATGTTGAAAAGCAAGTTTATTTTGTTGCCGACATTGAAAACTTATCTCCCCTGGCATGT GCCTATGCTAGGGCCCGTGGTGCTGATAGAATGTCTTCCTTTGGTGATTGGATTGCTCTT TCCAACATAGTTGATGTTCCAACAGCTAAGATCATATCTAGAGAAGTTTCTGATGGTGTT ATTGCCCCAGGTTATGAGCCTGAGGCGTTGGCCATTCTATCCAAGAAGAAGGGAGGTAAG TACTGCATATTACAAATTGATCCAAACTATGTTCCAGAAGCTGTCGAAAGAAGACAAGTA TACGGTGTGACTTTGGAACAAAAGAGAAACGATGCCATAATCAATCAATCAACTTTCAAA GAAATTGTTTCTCAAAATAAAAATCTCACTGAACAAGCCATAATTGATTTAACGGTTGCC ACCATTGCTATTAAATATACTCAATCTAATTCCGTATGTTATGCTAGAAATGGTATGGTT GTCGGATTGGGTGCAGGTCAACAATCTAGAATCCATTGTACAAGATTAGCTGGTGATAAG GCTGATAATTGGTGGTTCAGACAACACCCTAGAGTTTTGGAGATTAAATGGGCTAAAGGC GTCAAGAGACCAGAAAAATCTAATGCTATCGATTTATTCGTAACCGGCCAAATTCCAACA GAAGAACCAGAATTGTCTGAATACCAATCGAAGTTCGAGGAGATTCCAAAACCATTTACT CCAGAAGAAAGAAAGGAATGGTTGAGTAAATTAACCAACGTTTCTTTGTCATCGGATGCA TTTTTCCCATTCCCAGACAATGTTTACAGAGCAGTTAAATCCGGTGTCAAATACATTGCC GCTCCATCTGGTTCTGTCATGGACAAGGTTGTATTTTCAGCTGCCGATTCATTCGATTTG GTTTACGTAGAGAACCCAATCCGTTTGTTCCACCATTAG
Protein Properties
Pfam Domain Function
Protein Residues592
Protein Molecular Weight65262.60156
Protein Theoretical pI6.52
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Bifunctional purine biosynthesis protein ADE17 MANYTKTAILSVYDKTGLLDLARGLIEKNVRILASGGTARMIRDAGFPIEDVSAITHAPE MLGGRVKTLHPAVHGGILARDIDSDEKDLKEQHIEKVDYVVCNLYPFKETVAKVGVTIPE AVEEIDIGGVTLLRAAAKNHARVTILSDPKDYSEFLSELSSNGEISQDLRNRLALKAFEH TADYDAAISDFFRKQYSEGQAQITLRYGANPHQKPAQAYVSQQDSLPFKVLCGSPGYINL LDALNSWPLVKELSASLNLPAAASFKHVSPAGAAVGIPLSDVEKQVYFVADIENLSPLAC AYARARGADRMSSFGDWIALSNIVDVPTAKIISREVSDGVIAPGYEPEALAILSKKKGGK YCILQIDPNYVPEAVERRQVYGVTLEQKRNDAIINQSTFKEIVSQNKNLTEQAIIDLTVA TIAIKYTQSNSVCYARNGMVVGLGAGQQSRIHCTRLAGDKADNWWFRQHPRVLEIKWAKG VKRPEKSNAIDLFVTGQIPTEEPELSEYQSKFEEIPKPFTPEERKEWLSKLTNVSLSSDA FFPFPDNVYRAVKSGVKYIAAPSGSVMDKVVFSAADSFDLVYVENPIRLFHH
References
External Links
ResourceLink
Saccharomyces Genome Database ADE17
Uniprot IDP38009
Uniprot NamePUR92_YEAST
GenBank Gene IDZ49273
Genebank Protein ID809579
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Garrels, J. I., Futcher, B., Kobayashi, R., Latter, G. I., Schwender, B., Volpe, T., Warner, J. R., McLaughlin, C. S. (1994). "Protein identifications for a Saccharomyces cerevisiae protein database." Electrophoresis 15:1466-1486.7895733
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956