You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphatidylinositol 4-kinase STT4
Synonyms
  • PI4-kinase
  • PtdIns-4-kinase
Gene NameSTT4
Enzyme Class
Biological Properties
General FunctionInvolved in binding
Specific FunctionActs on phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,- trisphosphate. STT4 functions in PKC1 protein kinase pathway
Cellular LocationNot Available
SMPDB Pathways
Inositol phosphate metabolismPW002495 ThumbThumb?image type=greyscaleThumb?image type=simple
Stress-activated signalling pathways: cell wall stress test 1PW007861 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Inositol phosphate metabolismec00562 Map00562
SMPDB Reactions
PI(18:0/20:4(5Z,8Z,11Z,14Z)) + phosphatePIP(18:0/20:4(5Z,8Z,11Z,14Z))
KEGG Reactions
Adenosine triphosphate + 1-Phosphatidyl-D-myo-inositol → 1-phosphatidyl-1D-myo-inositol 4-phosphate + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB002301-Phosphatidyl-D-myo-inositolShow
YMDB00907phosphateShow
YMDB00914ADPShow
YMDB16196PI(18:0/20:4(5Z,8Z,11Z,14Z))Show
YMDB16197PIP(18:0/20:4(5Z,8Z,11Z,14Z))Show
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
binding
kinase activity
phosphotransferase activity, alcohol group as acceptor
inositol or phosphatidylinositol kinase activity
Process
regulation of cellular process
signal transduction
organophosphate metabolic process
phospholipid metabolic process
intracellular signal transduction
second-messenger-mediated signaling
phosphoinositide-mediated signaling
glycerophospholipid metabolic process
metabolic process
phosphoinositide metabolic process
phosphoinositide phosphorylation
biological regulation
regulation of biological process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR305C
Gene Sequence>5703 bp ATGAGATTTACCAGAGGATTGAAAGCCTCTTCATCTTTAAGAGCGAAAGCTATTGGAAGA CTAACTAAACTTTCGACGGGTGCACCAAATGATCAAAACAGTAATGGTACAACATTAGAT TTGATAACTCATACATTGCCTATTTTTTATTCCACAAATACGTCAAAGATATATACTATA CCACTTACATTGAGTGAATGGGAAGTACTAACTTCGCTTTGTGTTGCAATCCCTACCACG CTCGATCTGGTAGAGACAATGCTTAAAGAAATAATTGCGCCTTATTTTCTGGAAACTCCA AGACAAAGAATTTCAGATGTTCTGTCCTCGAAATTCAAGTTGGAACAGATGAGAAATCCG ATTGAATTGCTAACTTTCCAGCTGACTAAGTTTATGATTCAAGCTTGTGAACAGTATCCC GTTCTTTATGAAAATATAGGCGGCATCATTTCAACTTATTTTGAGCGTGTATTAAAGATT TTTACTATTAAACAATCTGGTCTACTATCATTAGTGGGCTTTATTAATGCATTTATCCAG TTTCCCAACTCTACAGAGCTTACTAAATTCACCTGGAAAAAGTTAGCGAAACTTGTGCTT CGTGGATCATTTCTAAACGAAGTTGATAAGATTTTGAATTCCTCAGCAACGTTTACCAAT GATTCAATCGTCCAGTATTACGATGCTGGAAATGAGCTATCCAGTGCCTACTTATTGGAA TTAATATCTCGCTTGCAAGTTTCGCTAATATCTCATCTGTTAAACACTTCACATGTCGGC GCCAACTTGAGTGAGTTCTTACTAAATCAACAATACCAATTTTACAAATTTGATCAAGAA GTAGCCGATGAAAACGATGATACGAAGTGTATTGATGACTTTTTTTTCAACGTAAGAAGC AATAAACAGTTTTTTACAGACATGTGTAAAATTTCCCTGCAATTTTGTTCTGAGTCACAT ATTCTCGACCTATCTACAGACAACCGTGCAAGATTTTCTTTTGATACTCGAGCCCACTAC CTACAAACGCTATGTTTAATTCCGTTTATAGAAGATACAGAAAGCGAGCTTTTTGAAAGT TTTACAAACGTTGTTTCTGAATCTATTGATAAATTTTTCTTATCTGATGTCGTTACACCA TCTTTGATAAAAGCAATTGTAGCTTCTGCCTCATTACTGAATTTTTTCACGGAAAAATTG TCATTAACTCTGATTCGTATGTTTCCTTTATTGGTAGCGTCTCCACATATCACGACTGAA ACAGTTAATGATGTTGCAAAAATATTCACCACAGGGTTATACCCTCTAAATGAAGATGCA ATTGTGAGTACAATTTATTCCATGAACAACTTATTAGCTGTTTCCGAGGACGGATCGCCC GTCCCGGTGCTCCGTGAGCGCCAATTAACAATAACATCTGGAAAAAATATTGAGAAAGAC TACTTTCCCTTGCGAAATTCATCTGCCAGTTTGGATGGCACTGGTGCTCTGCTCGGAAAT ACAACTGTGGGCCAACTTTCCTCCCATGATGTCAATAGTGGAGCTACTATGACATACCAT GCCTCTTTGATATCTAATTGTGTGGCTGCAACGACTACAATCGCCTCATACTATAACACC CAAAGCATAACAGCTTTGACTATCTCTATTCTTACGCAAAAAGTTAATTCTATGTCAAAG GAATTAGACGGTGTTATTTTGAATTCTTTGGCAAGACTGGCTCCGAATACTTCACTGACA GAATTTTCGCTTTTACTAAAGTTCTTCAAATCGAGAACTGTTATTGCAACAAAAATTGAT GATAGCGCACTATTGAAAAATATTATTAAAGCGAAATGTGTGATATCAAAAGAATTGTTG GCCAGGCATTTTTCAAGTGACTTATATTTCATGTATCTTCATGATCTATTGGACTCAATT ATTGCCAGTGGGGAAGTAGAACGATTGGAACATCACAGACCTCAAACGGAGATTTCCCGT GTTGCTGATCAAATCGCTACCTACTTAGAGCCCCTCGCCGCTCTACTACCTGTTCCAGGC GATACGCCATTGGACATCAATAAGGATGAAGTCACTACAAACAAGTTTAGGAACGCCTGG TTTAATTTTGTCATCCATGGGTACCACTTGGGCGGGCCTATTGTCAAACGAAATTTTTCT TTCTTATTAACTATTGCCTATAATTCACCACCGCTGGCTTCTGAATTTCCTGCTAATAAC AAGGAGCTTTCATTGGAAATGAATACAATTTTGCGCCGCGGTTCATCTAACGAAAATATC AAACAACAAAAACAGCAGATAACCGAATATTTCAATACCAATATTGTTCAGTACAGAACA ACTTCATCGTCTAAAATCATGTTTTTAGCGGCTGCCGTTCTTCTAGAAACGATAAGATGC GAGGCAGGTGATTGTTCGAAGACTCTACTGTACTTCTCAGACCCCTCCATTCTTTCCGGT TCAATTGAGAAGTGTATTGCAGTTTTGTCGGTTTCCATGATTAGAAAATATGCTAGGTTG ATTCAAAAGGGTAACGATGCCATATTCAACTCCAAAATGATTGCTCAACAACTTAATAAC TTGCTACTTTGCCTTTCTCATAGGGAACCAACTTTGCAGGATGCCGCTTTTCATGCCTGT GAAATATTTATCAGATCTATTCCATCATCGTTATGTCATCATTTGTCTCTCTACACCTTA TTAGATATGTTAACAGCCCTATTTGATAGTATCTTGGACTCAGAGGCGCATAAATTTGAA CCACGGTATGAATTTAAATTAAAACATTCTAAGACAACAATATTGGTTCCAAGCTCATCG TCCTGGCGCGCTACGACACTATCAAGATTGCACAAGTCAGCTAAAGAATGGGTAAGAATT CTATTGAATAGAAGCAACCAGGATACTAAGATTTTGTTGCAATCATACATATCAGATCTC GGTGAGTACAGCAGGCTAAATTCTGTTGAATTTGGTGTCTCATTTGCCATGGATATGGCT GGTTTGATTTTACCTGCAGATAAGGAATTATCAAGGCTTACTTATTATGGTCCAGAGAAA CCTAACACGATTTCTGGATTTATATCTTTACATTCTTGGAGGTCAAAATATCTTTTCGAT ACCGCTATTACATCATCACCAGAGGATATCAAAAGGCAAATAGGTATTTCCACTCAAAAC ATAAGAAAAAATTTGACCTTAGGAAATAAGATTATAACTAAAGACGTAACTGATTTTCTT GATATGGCTACCGCGTTGTTAATTCTTGGCAATGGTGCACCAGCGTCATTGATATATGAT ATTGTGCACATCCCGTTCGAAGTCTTCACCTCTGCATCTTTAAAGATTGCTACAAACGTA TGGTTAACAATCATAACTGAGAAGCCCGAAGTTGCACATTTGCTTTTAGTTGAAGTATGC TATTGCTGGATGCGCTCCATTGATGACAATATTGGTCTCTATTCTCGCGATCATGACTTA AAGGGCGAAGAATACCAAAAAATGGAATATTCCCCTTACGACAAAGCAGGTATCAACAGA GATGCAAAAAATGCATCCCAAGCTATGCAACCACATCTTCATGTTATTAAATTTTTTGCT TCCCATTTCGAGGGCACACTATTTCAAAGTGACTTTTTATTGAAAATTTTCACGAAATGT GCGCTTTATGGTATCAAGAATCTGTATAAGGCTTCACTACACCCGTTCGCTAGAATGATT CGCCACGAATTATTGTTATTCGCGACTCTCGTACTAAACGCAAGTTATAAGCAGGGATCC AAGTATATGGGCCGTTTGTCGCAAGAAATCACAAACGGTGCCCTAAGTTGGTTTAAAAGA CCAGTAGCGTGGCCATTCGGCTCAAATGAGCTGAAAATCAAAGCAGATTTATCTGTTACT AGGGACCTTTTCCTTCAGCTCAACAAATTAAGCTCGCTAATGTCACGTCATTGCGGGAAA GATTACAAGATCCTGAACTATTTCTTGGCAAGCGAAATCCAGCAGATTCAAACCTGGCTT ACTCCGACTGAGAAGATTGAAGGAGCCGACAGCAACGAGCTTACAAGCGATATCGTTGAA GCTACCTTTGCTAAAGATCCAACATTAGCAATAAATCTCTTACAACGATGTTATAGCAAG AAAGCTGAGGATGTTTTAGTGGGCTTAGTTGCAAAACATGCTTTAATGTGTGTGGGGTCC CCAAGTGCTCTTGACCTGTTCATAAAAGGAAGCCACCTGAGCAGTAAGAAAGACCTACAC GCAACCTTATACTGGGCGCCAGTGAGCCCGTTAAAATCTATCAACCTTTTCCTTCCCGAA TGGCAAGGTAATTCTTTTATCTTACAATTCAGCATATATTCGTTGGAATCACAAGATGTG AACTTGGCATTCTTCTATGTTCCTCAAATCGTACAATGTTTGAGATACGATAAAACCGGA TATGTCGAAAGATTGATTTTGGATACTGCGAAAATTAGTGTGTTATTTTCTCATCAAATA ATCTGGAATATGCTTGCAAACTGCTACAAGGATGATGAAGGTATACAAGAAGATGAAATC AAACCAACTCTAGATCGTATTAGGGAGCGTATGGTTTCAAGTTTCAGCCAATCTCATCGC GATTTTTACGAACGTGAATTTGAATTCTTCGACGAAGTAACTGGCATATCTGGTAAGTTG AAACCATACATAAAAAAAAGTAAGGCTGAAAAGAAACATAAGATCGATGAAGAAATGAGC AAAATTGAGGTGAAACCTGATGTTTATTTACCTTCTAATCCTGACGGTGTAGTTATTGAT ATTGATCGGAAGAGTGGTAAGCCACTTCAATCTCACGCAAAGGCGCCTTTTATGGCGACC TTTAAAATAAAGAAAGACGTAAAAGATCCTTTGACAGGTAAAAACAAGGAAGTTGAAAAA TGGCAAGCTGCTATCTTCAAAGTCGGTGATGACTGTAGGCAAGATGTTCTAGCGTTACAA TTGATCTCGCTATTTAGAACCATTTGGTCTAGTATTGGCTTGGATGTCTACGTTTTTCCC TACAGAGTTACTGCGACGGCACCGGGTTGTGGTGTCATCGATGTGCTACCCAATTCGGTA TCCCGTGATATGTTAGGACGTGAAGCTGTTAATGGATTATATGAATATTTCACTAGTAAA TTTGGTAATGAATCTACTATCGAATTTCAAAACGCACGAAACAACTTTGTTAAATCCTTA GCGGGATATAGCGTAATTTCGTATTTGTTGCAATTCAAGGATAGACATAATGGTAACATT ATGTACGATGATCAAGGACATTGTCTACATATCGATTTTGGGTTTATTTTTGATATTGTC CCAGGTGGTATCAAGTTTGAAGCAGTACCATTCAAGCTGACGAAAGAAATGGTTAAAGTG ATGGGAGGTTCGCCCCAGACCCCAGCGTATCTGGACTTTGAAGAACTTTGTATCAAGGCA TATCTAGCCGCCCGTCCGCACGTGGAGGCCATAATTGAGTGTGTAAATCCTATGTTAGGA AGCGGTCTCCCCTGCTTTAAGGGTCACAAGACAATTAGGAATCTAAGAGCAAGATTTCAA CCTCAAAAAACCGATCACGAAGCTGCACTATATATGAAGGCGCTAATCCGTAAAAGTTAT GAAAGTATATTCACTAAAGGTTATGATGAATTCCAAAGGCTCACAAATGGCATTCCGTAC TGA
Protein Properties
Pfam Domain Function
Protein Residues1900
Protein Molecular Weight214605.0
Protein Theoretical pI7.51
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphatidylinositol 4-kinase STT4 MRFTRGLKASSSLRAKAIGRLTKLSTGAPNDQNSNGTTLDLITHTLPIFYSTNTSKIYTI PLTLSEWEVLTSLCVAIPTTLDLVETMLKEIIAPYFLETPRQRISDVLSSKFKLEQMRNP IELLTFQLTKFMIQACEQYPVLYENIGGIISTYFERVLKIFTIKQSGLLSLVGFINAFIQ FPNSTELTKFTWKKLAKLVLRGSFLNEVDKILNSSATFTNDSIVQYYDAGNELSSAYLLE LISRLQVSLISHLLNTSHVGANLSEFLLNQQYQFYKFDQEVADENDDTKCIDDFFFNVRS NKQFFTDMCKISLQFCSESHILDLSTDNRARFSFDTRAHYLQTLCLIPFIEDTESELFES FTNVVSESIDKFFLSDVVTPSLIKAIVASASLLNFFTEKLSLTLIRMFPLLVASPHITTE TVNDVAKIFTTGLYPLNEDAIVSTIYSMNNLLAVSEDGSPVPVLRERQLTITSGKNIEKD YFPLRNSSASLDGTGALLGNTTVGQLSSHDVNSGATMTYHASLISNCVAATTTIASYYNT QSITALTISILTQKVNSMSKELDGVILNSLARLAPNTSLTEFSLLLKFFKSRTVIATKID DSALLKNIIKAKCVISKELLARHFSSDLYFMYLHDLLDSIIASGEVERLEHHRPQTEISR VADQIATYLEPLAALLPVPGDTPLDINKDEVTTNKFRNAWFNFVIHGYHLGGPIVKRNFS FLLTIAYNSPPLASEFPANNKELSLEMNTILRRGSSNENIKQQKQQITEYFNTNIVQYRT TSSSKIMFLAAAVLLETIRCEAGDCSKTLLYFSDPSILSGSIEKCIAVLSVSMIRKYARL IQKGNDAIFNSKMIAQQLNNLLLCLSHREPTLQDAAFHACEIFIRSIPSSLCHHLSLYTL LDMLTALFDSILDSEAHKFEPRYEFKLKHSKTTILVPSSSSWRATTLSRLHKSAKEWVRI LLNRSNQDTKILLQSYISDLGEYSRLNSVEFGVSFAMDMAGLILPADKELSRLTYYGPEK PNTISGFISLHSWRSKYLFDTAITSSPEDIKRQIGISTQNIRKNLTLGNKIITKDVTDFL DMATALLILGNGAPASLIYDIVHIPFEVFTSASLKIATNVWLTIITEKPEVAHLLLVEVC YCWMRSIDDNIGLYSRDHDLKGEEYQKMEYSPYDKAGINRDAKNASQAMQPHLHVIKFFA SHFEGTLFQSDFLLKIFTKCALYGIKNLYKASLHPFARMIRHELLLFATLVLNASYKQGS KYMGRLSQEITNGALSWFKRPVAWPFGSNELKIKADLSVTRDLFLQLNKLSSLMSRHCGK DYKILNYFLASEIQQIQTWLTPTEKIEGADSNELTSDIVEATFAKDPTLAINLLQRCYSK KAEDVLVGLVAKHALMCVGSPSALDLFIKGSHLSSKKDLHATLYWAPVSPLKSINLFLPE WQGNSFILQFSIYSLESQDVNLAFFYVPQIVQCLRYDKTGYVERLILDTAKISVLFSHQI IWNMLANCYKDDEGIQEDEIKPTLDRIRERMVSSFSQSHRDFYEREFEFFDEVTGISGKL KPYIKKSKAEKKHKIDEEMSKIEVKPDVYLPSNPDGVVIDIDRKSGKPLQSHAKAPFMAT FKIKKDVKDPLTGKNKEVEKWQAAIFKVGDDCRQDVLALQLISLFRTIWSSIGLDVYVFP YRVTATAPGCGVIDVLPNSVSRDMLGREAVNGLYEYFTSKFGNESTIEFQNARNNFVKSL AGYSVISYLLQFKDRHNGNIMYDDQGHCLHIDFGFIFDIVPGGIKFEAVPFKLTKEMVKV MGGSPQTPAYLDFEELCIKAYLAARPHVEAIIECVNPMLGSGLPCFKGHKTIRNLRARFQ PQKTDHEAALYMKALIRKSYESIFTKGYDEFQRLTNGIPY
References
External Links
ResourceLink
Saccharomyces Genome Database STT4
Uniprot IDP37297
Uniprot NameSTT4_YEAST
GenBank Gene IDD13717
Genebank Protein ID454207
General Reference
  • Yoshida, S., Ohya, Y., Goebl, M., Nakano, A., Anraku, Y. (1994). "A novel gene, STT4, encodes a phosphatidylinositol 4-kinase in the PKC1 protein kinase pathway of Saccharomyces cerevisiae." J Biol Chem 269:1166-1172.8288577
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956