You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameN-terminal acetyltransferase 2
Synonyms
  • Amino-terminal, alpha-amino, acetyltransferase 2
Gene NameNAT2
Enzyme Class
Biological Properties
General FunctionInvolved in peptide alpha-N-acetyltransferase activity
Specific FunctionN-terminal acetylation of proteins. N-acetylation plays a role in normal eukaryotic translation and processing, protect against proteolytic degradation and protein turnover. NAT2 acts on proteins with a N-terminal methionine
Cellular LocationCytoplasm (Probable)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00312Acetyl-CoAShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 7
LocusYGR147C
Gene Sequence>867 bp ATGATGGTACCCAGGATTAGTGCTTCACCAGTTTTCAAGAGGATATTTCTTCGATGGGGA TTTGTAACTTTACCCATACAGAAAACCGTATCCCATACACTGCGCAGGGACTTTAGTGCC CCTTGTAGGAGTATGGTAAAATGCCTTCTCCTACGACCTGGGATAAGTGTGCACTCAGCC AAAGACAGCAAATTTTACAGTACAGAGGAAAAAAGTAGTCAGTTTGATGAAAATAAAAGC AAAAGTAACAATGGGAAGAAAAATGAGCCACACGGTATTAAAGGATTAATGGCTAAGTAT GGTTATTCTGCACTGATCGTATATATCCTCTTAACTTGTGTTGATTTGCCATTATGTTTT CTGGGAGTCCACTCACTAGGTGAAGAGAAGATTAAGATCTATCTGAACAGAGGTAAGCAA TTGATTGGGATGGGTGAGCCTGACGAAAGCAAAGTCATTCAAGATGTTAGAAGGAAACAG GCTCATCGCGAAGCAGTGCAAGCAGAGAATGCTGACAAGGTGGAGGACGCATCGAGGAAA ACTTTCAATGAGAGATGGCAAGAGATGAAGGACAGCACGTTGTTGGCCGAATTGCTAATT GCGTATGGCATACACAAGAGTTTGATCATCGTTAGAGTACCCCTGACGGCACTGCTAACG CCATCCTTCGTCAAGCTTCTGCAGAGGTTTGGCATCGACTTGATGAAGAAGCAGAAAAAG GTATTCCAAACGATGGCCTCTGGTGCCAAAATAAGATACAAAGGGAACAACCCTAGCGAT TTCATCAAGAATGAGGGCACAGCGCTCGACATTACAAAGCGCAAACCAAGAACCAAAGGC CAGAAATGGTTTGATGGCCTAATGTAG
Protein Properties
Pfam Domain Function
Protein Residues288
Protein Molecular Weight32804.19922
Protein Theoretical pI10.61
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>N-terminal acetyltransferase 2 MMVPRISASPVFKRIFLRWGFVTLPIQKTVSHTLRRDFSAPCRSMVKCLLLRPGISVHSA QDRKFYSTEEKSSQFDENKSKSNNGKKNEPHGIKGLMAKYGYSALIVYILLTCVDLPLCF LGVHSLGEEKIKIYLNRGKQLIGMGEPDESKVIQDVRRKQAHREAVQAENADKVEDASRK TFNERWQEMKDSTLLAELLIAYGIHKSLIIVRVPLTAVLTPSFVKLLQRFGIDLMKKQKK VFQTMASGAKIRYKGNNPSDFIKNEGTALDITKRKPRTKGQKWFDGLM
References
External Links
ResourceLink
Saccharomyces Genome Database NAT2
Uniprot IDP37293
Uniprot NameNAT2_YEAST
GenBank Gene IDL25608
Genebank Protein ID497619
General Reference
  • Kulkarni, M. S., Sherman, F. (1994). "NAT2, an essential gene encoding methionine N alpha-acetyltransferase in the yeast Saccharomyces cerevisiae." J Biol Chem 269:13141-13147.8175741
  • Skala, J., Nawrocki, A., Goffeau, A. (1995). "The sequence of a 27 kb segment on the right arm of chromosome VII from Saccharomyces cerevisiae reveals MOL1, NAT2, RPL30B, RSR1, CYS4, PEM1/CHO2, NSR1 genes and ten new open reading frames." Yeast 11:1421-1427.8585325
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106