You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSerine hydroxymethyltransferase, cytosolic
Synonyms
  • SHMT
  • Glycine hydroxymethyltransferase
  • Serine methylase
Gene NameSHM2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionInterconversion of serine and glycine
Cellular LocationCytoplasm
SMPDB Pathways
glycine metabolismPW002398 ThumbThumb?image type=greyscaleThumb?image type=simple
serine metabolismPW002402 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cyanoamino acid metabolismec00460 Map00460
Glycine, serine and threonine metabolismec00260 Map00260
Methane metabolismec00680 Map00680
One carbon pool by folateec00670 Map00670
SMPDB Reactions
L-Serine + Tetrahydrofolic acidwater + Glycine + 5,10-Methylene-THF
KEGG Reactions
L-Serine + 5,6,7,8-Tetrahydrofolic acidGlycine + water + 5,10-Methylene-THF
Metabolites
YMDB IDNameView
YMDB00016GlycineShow
YMDB00112L-SerineShow
YMDB00139Tetrahydrofolic acidShow
YMDB002605,10-Methylene-THFShow
YMDB004835,6,7,8-Tetrahydrofolic acidShow
YMDB00848(6R)-5,10-methylenetetrahydrofolic acidShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
pyridoxal phosphate binding
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
glycine hydroxymethyltransferase activity
binding
cofactor binding
Process
serine family amino acid metabolic process
glycine metabolic process
L-serine metabolic process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR058C
Gene Sequence>1410 bp ATGCCTTACACTCTATCCGACGCTCATCATAAGTTGATCACCTCTCATTTGGTGGACACC GACCCTGAAGTGGACTCCATTATCAAGGATGAAATTGAAAGACAAAAGCACTCCATCGAT TTGATTGCTTCTGAAAATTTCACCTCAACCTCCGTTTTCGATGCCCTTGGAACTCCATTG TCCAACAAATATTCTGAAGGTTATCCAGGTGCTCGTTACTACGGTGGTAATGAACACATT GACAGAATGGAAATTCTATGTCAACAAAGAGCTTTGAAAGCTTTCCATGTTACTCCAGAC AAATGGGGTGTTAACGTCCAAACTTTATCTGGTTCTCCTGCTAACTTGCAAGTTTATCAA GCTATTATGAAGCCTCATGAAAGATTGATGGGTCTATACCTACCAGATGGTGGTCATTTG TCTCACGGTTACGCTACTGAAAACAGAAAAATTTCTGCTGTTTCCACATACTTTGAATCT TTCCCATACAGAGTTAACCCAGAAACCGGTATTATCGACTACGATACTTTAGAAAAGAAC GCCATCCTATATAGACCAAAGGTTCTTGTTGCTGGTACTTCAGCATACTGTCGTTTAATT GACTACAAGAGAATGAGAGAAATCGCCGACAAATGTGGTGCTTACTTGATGGTAGACATG GCCCACATTTCTGGTTTGATCGCCGCAGGTGTCATCCCATCTCCTTTCGAATACGCTGAT ATCGTTACCACCACCACTCACAAGTCTTTGAGAGGTCCACGTGGTGCTATGATTTTCTTC AGAAGAGGTGTGAGATCTATCAACCCTAAGACCGGTAAGGAAGTTCTATACGACTTGGAA AACCCAATTAACTTCTCTGTTTTCCCAGGTCACCAAGGTGGTCCACACAACCATACCATT GCTGCTTTGGCCACTGCTTTGAAGCAAGCTGCCACTCCAGAATTCAAGGAATACCAAACT CAAGTCTTGAAGAATGCTAAGGCTTTGGAAAGTGAATTTAAGAACTTGGGCTACAGATTA GTTTCCAACGGTACCGATTCTCACATGGTTCTAGTATCCTTGAGAGAAAAGGGTGTTGAT GGTGCTCGTGTTGAATACATTTGTGAAAAGATTAACATTGCTTTGAACAAAAATTCTATT CCAGGTGACAAATCTGCTTTGGTTCCAGGTGGTGTCCGTATTGGGGCTCCAGCCATGACC ACTAGAGGAATGGGTGAAGAAGATTTCCACAGAATTGTTCAATACATTAACAAGGCTGTA GAATTCGCTCAACAAGTTCAACAAAAGCTTCCAAAGGATGCTTGTAGATTAAAGGACTTC AAAGCCAAGGTCGACGAAGGCTCTGATGTTTTGAACACCTGGAAAAAGGAAATTTACGAC TGGGCTGGCGAATACCCATTGGCTGTGTAA
Protein Properties
Pfam Domain Function
Protein Residues469
Protein Molecular Weight52218.0
Protein Theoretical pI7.47
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Serine hydroxymethyltransferase, cytosolic MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTSTSVFDALGTPL SNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPDKWGVNVQTLSGSPANLQVYQ AIMKPHERLMGLYLPDGGHLSHGYATENRKISAVSTYFESFPYRVNPETGIIDYDTLEKN AILYRPKVLVAGTSAYCRLIDYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYAD IVTTTTHKSLRGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMVLVSLREKGVD GARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMTTRGMGEEDFHRIVQYINKAV EFAQQVQQSLPKDACRLKDFKAKVDEGSDVLNTWKKEIYDWAGEYPLAV
References
External Links
ResourceLink
Saccharomyces Genome Database SHM2
Uniprot IDP37291
Uniprot NameGLYC_YEAST
GenBank Gene IDL22529
Genebank Protein ID439120
General Reference
  • McNeil, J. B., McIntosh, E. M., Taylor, B. V., Zhang, F. R., Tang, S., Bognar, A. L. (1994). "Cloning and molecular characterization of three genes, including two genes encoding serine hydroxymethyltransferases, whose inactivation is required to render yeast auxotrophic for glycine." J Biol Chem 269:9155-9165.8132653
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Norbeck, J., Blomberg, A. (1997). "Two-dimensional electrophoretic separation of yeast proteins using a non-linear wide range (pH 3-10) immobilized pH gradient in the first dimension; reproducibility and evidence for isoelectric focusing of alkaline (pI > 7) proteins." Yeast 13:1519-1534.9509572
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956