You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name6-phosphogluconolactonase-like protein 2
Synonyms
  • Suppressor of LOS1
Gene NameSOL2
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in 6-phosphogluconolactonase activity
Specific FunctionMay be involved in regulation of tRNA subcellular distribution
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
water + 6-Phosphonoglucono-D-lactone6-Phosphogluconic acid + hydron
Metabolites
YMDB IDNameView
YMDB001406-Phosphonoglucono-D-lactoneShow
YMDB002186-Phosphogluconic acidShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
6-phosphogluconolactonase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
carboxylesterase activity
Process
glucose catabolic process
pentose-phosphate shunt
metabolic process
primary metabolic process
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
Gene Properties
Chromosome Locationchromosome 3
LocusYCR073W-A
Gene Sequence>948 bp ATGACTACGACGGTACCCAAGATATTCGCGTTTCACGAGTTTTCAGACGTGGCAGAGGCC GTAGCTGACCATGTAGTCCACGCGCAAGACGGTGCATTGGCTCCAAAGAACGAGAGGAAA CACTCTGTTCCCAACATCAGCATGAATGCACTGGATATGACGAGAGAGGCCTCTTGCAAA AGCACAGCATCTGCCGCGGAAGGGAAAAGTGGTAGCAGTGGTAGTGGCAGTGGTAGCAGT AAGCCCAAAAAGGAGAAACGGTTCAAGATTGCTCTCTCCGGTGGGTCATTGATCGAAGTG CTACACGAAGGTCTGCTAAAACGAGACGATGTACGGTGGGGAGACTGGGACATTTACTTT GCAGACGAGAGACTTGTACCCTTCAGCTCGAATGAAAGCAATTATGGATGCGCCAAAAGG AAGATTTTGGACCTGATAGACACGGCGAAGTATGGAACTCCGAAGGTGTACCACATTGAC GAGTCATTGATTGACGACCCGCAAGAATGCGCTGATAACTATGAAAAGGTGCTAATCCGC GGGTTTGCCGGTAGAGATTCCGTCAAACTTCCGATGTTCGACTTGTTCCTGCTTGGTTGT GCCCCCGATGGTCATATCGCATCACTCTTCCCTAACTTCCAGGACAATCTACGTGAGAAA CTTGCATGGGTGGTGCCCGTGGAGAACGCTCCTAGTGGGCCCTCGACCAGAATTTCGCTG ACTATACCTGTAATCTGCCATTCTCACAGGGTTACTTTCGTTGTCGAAGGTGCAACCAAG GCGCCCATCATCAAGACCATTATGGAAAGGCCTGAAAAGGGCCTACCTAGCAGTATTGTC AACGAAGGTGCTGCTGGTCGTGTATCATGGTTTGTTGACGACGATGCTCTTACGGACGTC CTCGTCACCAAAAAAAAGTATAAATTCCACCAAGGTTTGTCTATTTAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues315
Protein Molecular Weight34500.89844
Protein Theoretical pI6.85
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>6-phosphogluconolactonase-like protein 2 MTTTVPKIFAFHEFSDVAEAVADHVVHAQDGALAPKNERKHSVPNISMNALDMTREASCK STASAAEGKSGSSGSGSGSSKPKKEKRFKIALSGGSLIEVLHEGLLKRDDVRWGDWDIYF ADERLVPFSSNESNYGCAKRKILDLIDTAKYGTPKVYHIDESLIDDPQECADNYEKVLIR GFAGRDSVKLPMFDLFLLGCAPDGHIASLFPNFQDNLREKLAWVVPVENAPSGPSTRISL TIPVICHSHRVTFVVEGATKAPIIKTIMERPEKGLPSSIVNEGAAGRVSWFVDDDALTDV LVTKKKYKFHQGLSI
References
External Links
ResourceLink
Saccharomyces Genome Database SOL2
Uniprot IDP37262
Uniprot NameSOL2_YEAST
GenBank Gene IDU46559
Genebank Protein ID1184941
General Reference
  • Shen, W. C., Stanford, D. R., Hopper, A. K. (1996). "Los1p, involved in yeast pre-tRNA splicing, positively regulates members of the SOL gene family." Genetics 143:699-712.8725220
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Koonin, E. V., Bork, P., Sander, C. (1994). "Yeast chromosome III: new gene functions." EMBO J 13:493-503.8313894
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Stanford, D. R., Whitney, M. L., Hurto, R. L., Eisaman, D. M., Shen, W. C., Hopper, A. K. (2004). "Division of labor among the yeast Sol proteins implicated in tRNA nuclear export and carbohydrate metabolism." Genetics 168:117-127.15454531
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956