You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAminodeoxychorismate synthase
Synonyms
  • ADC synthase
  • P-aminobenzoic acid synthase
  • PABA synthase
  • Para-aminobenzoate synthase
Gene NameABZ1
Enzyme Class
Biological Properties
General FunctionInvolved in biosynthetic process
Specific FunctionCatalyzes the biosynthesis of 4-amino-4-deoxychorismate (ADC) from chorismate and glutamine. Required for the synthesis of 4-aminobenzoate (PABA), an important component in tetrahydrofolate biosynthesis
Cellular LocationCytoplasm
SMPDB Pathways
tetrahydrofolate biosynthesisPW002417 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Folate biosynthesisec00790 Map00790
SMPDB Reactions
Chorismate + L-GlutamineL-Glutamic acid + 4-amino-4-deoxychorismate
KEGG Reactions
Chorismate + L-Glutamine4-amino-4-deoxychorismic acid + L-Glutamic acid
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00148ChorismateShow
YMDB00271L-Glutamic acidShow
YMDB003144-amino-4-deoxychorismic acidShow
YMDB162534-amino-4-deoxychorismateShow
GO Classification
Component
Not Available
Function
oxo-acid-lyase activity
anthranilate synthase activity
lyase activity
carbon-carbon lyase activity
catalytic activity
Process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
glutamine family amino acid metabolic process
metabolic process
glutamine metabolic process
biosynthetic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNR033W
Gene Sequence>2364 bp ATGCTGTCCGATACAATTGACACAAAGCAACAACAGCAACAGCTTCATGTCCTGTTCATA GACTCTTATGATTCATTCACCTACAATGTAGTGAGACTAATTGAACAACAAACTGATATC TCACCGGGAGTCAACGCCGTGCACGTGACGACGGTACATAGTGATACGTTCCAATCTATG GATCAGCTATTGCCACTTTTGCCGCTTTTTGATGCTATCGTTGTTGGCCCAGGACCTGGG AATCCCAACAATGATGCACAAGATATGGGTATAATATCTGAGCTTTTCGAGAATGCCAAT GGAAAGTTAGATGAAGTTCCAATATTGGGTATATGTCTTGGGTTCCAAGCAATGTGCTTG GCTCAAGGTGCTGATGTCAGTGAGCTAAATACTATCAAGCATGGGCAAGTGTATGAAATG CATTTAAACGATGCAGCCAGAGCTTGTGGCCTTTTTTCTGGTTATCCCGATACGTTCAAA TCTACGAGGTACCATTCATTGCATGTCAATGCCGAAGGCATTGACACCCTTTTGCCCTTA TGCACAACCGAAGATGAGAACGGTATTCTTTTGATGAGTGCTCAAACGAAAAATAAGCCA TGGTTTGGCGTACAGTACCACCCGGAGTCATGTTGTTCAGAATTGGGGGGGCTGTTAGTC AGTAACTTTCTCAAGTTGAGTTTCATAAATAACGTGAAGACAGGAAGGTGGGAAAAGAAG AAACTTAATGGAGAGTTTTCCGATATCCTATCTCGATTGGATAGGACTATTGATAGAGAC CCCATATACAAGGTAAAAGAGAAATATCCGAAGGGCGAGGACACAACTTACGTTAAGCAG TTCGAGGTCTCTGAAGACCCGAAATTGACATTTGAAATTTGCAACATCATACGAGAAGAA AAATTTGTCATGTCATCTTCTGTGATTAGTGAAAATACGGGTGAATGGTCTATCATTGCT TTACCAAACTCCGCATCCCAGGTATTCACTCATTATGGAGCTATGAAAAAGACTACAGTT CATTATTGGCAAGATAGTGAAATTAGTTACACCTTGTTGAAAAAGTGTCTAGATGGTCAA GATTCGGATTTGCCTGGCTCCCTTGAGGTAATACATGAAGATAAATCCCAATTTTGGATC ACTTTGGGTAAATTTATGGAGAATAAAATAATCGATAACCACAGAGAAATACCTTTTATT GGAGGTCTTGTTGGCATTTTAGGTTATGAAATAGGTCAGTACATTGCATGCGGCCGTTGC AATGATGATGAGAATTCCCTTGTTCCCGACGCCAAACTAGTTTTTATCAACAATAGTATA GTCATTAATCACAAGCAAGGGAAGCTTTATTGTATTTCTCTGGATAATACATTTCCAGTG GCATTAGAACAATCATTAAGGGACAGTTTTGTTAGAAAGAAGAATATTAAGCAATCCCTG TCCTGGCCCAAGTATCTTCCAGAGGAGATAGACTTCATTATAACTATGCCCGATAAACTT GACTACGCTAAGGCGTTTAAGAAATGTCAGGATTATATGCATAAGGGTGATTCTTATGAA ATGTGTCTCACAACGCAAACCAAAGTTGTACCATCTGCGGTGATAGAACCCTGGAGGATT TTCCAGACCTTGGTACAAAGAAACCCGGCTCCATTTTCAAGTTTTTTTGAGTTTAAAGAC ATTATTCCCCGCCAAGATGAAACGCCTCCAGTTTTGTGCTTCTTAAGTACTTCTCCAGAA AGGTTTTTGAAGTGGGATGCAGACACATGCGAGCTACGTCCCATCAAGGGAACTGTGAAA AAAGGACCGCAAATGAACTTGGCAAAAGCCACACGAATCCTGAAGACACCAAAAGAATTT GGTGAGAACTTAATGATTTTGGACTTAATCAGAAATGACCTTTACGAGTTGGTTCCTGAC GTTCGGGTGGAGGAGTTCATGTCCGTGCAAGAATATGCCACCGTTTACCAACTCGTTAGC GTCGTAAAGGCACATGGATTGACCTCTGCCAGTAAGAAGACGAGATATTCAGGCATTGAT GTCCTTAAACACTCGCTTCCTCCGGGATCTATGACGGGAGCCCCCAAGAAGATTACTGTG CAATTATTGCAGGACAAGATAGAAAGCAAGCTAAACAAACATGTCAATGGTGGAGCACGT GGTGTTTACAGCGGTGTCACGGGATATTGGTCTGTGAATTCCAACGGAGATTGGTCTGTT AACATTAGATGTATGTATTCCTACAACGGCGGAACCAGCTGGCAACTCGGTGCAGGGGGG GCCATAACAGTCTTAAGCACACTAGATGGCGAACTAGAGGAAATGTACAACAAGTTGGAG AGCAACTTACAAATTTTCATGTAG
Protein Properties
Pfam Domain Function
Protein Residues787
Protein Molecular Weight88543.5
Protein Theoretical pI5.55
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Aminodeoxychorismate synthase MLSDTIDTKQQQQQLHVLFIDSYDSFTYNVVRLIEQQTDISPGVNAVHVTTVHSDTFQSM DQLLPLLPLFDAIVVGPGPGNPNNGAQDMGIISELFENANGKLDEVPILGICLGFQAMCL AQGADVSELNTIKHGQVYEMHLNDAARACGLFSGYPDTFKSTRYHSLHVNAEGIDTLLPL CTTEDENGILLMSAQTKNKPWFGVQYHPESCCSELGGLLVSNFLKLSFINNVKTGRWEKK KLNGEFSDILSRLDRTIDRDPIYKVKEKYPKGEDTTYVKQFEVSEDPKLTFEICNIIREE KFVMSSSVISENTGEWSIIALPNSASQVFTHYGAMKKTTVHYWQDSEISYTLLKKCLDGQ DSDLPGSLEVIHEDKSQFWITLGKFMENKIIDNHREIPFIGGLVGILGYEIGQYIACGRC NDDENSLVPDAKLVFINNSIVINHKQGKLYCISLDNTFPVALEQSLRDSFVRKKNIKQSL SWPKYLPEEIDFIITMPDKLDYAKAFKKCQDYMHKGDSYEMCLTTQTKVVPSAVIEPWRI FQTLVQRNPAPFSSFFEFKDIIPRQDETPPVLCFLSTSPERFLKWDADTCELRPIKGTVK KGPQMNLAKATRILKTPKEFGENLMILDLIRNDLYELVPDVRVEEFMSVQEYATVYQLVS VVKAHGLTSASKKTRYSGIDVLKHSLPPGSMTGAPKKITVQLLQDKIESKLNKHVNGGAR GVYSGVTGYWSVNSNGDWSVNIRCMYSYNGGTSWQLGAGGAITVLSTLDGELEEMYNKLE SNLQIFM
References
External Links
ResourceLink
Saccharomyces Genome Database ABZ1
Uniprot IDP37254
Uniprot NamePABS_YEAST
GenBank Gene IDAY693029
Genebank Protein ID51013509
General Reference
  • Edman, J. C., Goldstein, A. L., Erbe, J. G. (1993). "Para-aminobenzoate synthase gene of Saccharomyces cerevisiae encodes a bifunctional enzyme." Yeast 9:669-675.8346682
  • Shen, W. C., Stanford, D. R., Hopper, A. K. (1996). "Los1p, involved in yeast pre-tRNA splicing, positively regulates members of the SOL gene family." Genetics 143:699-712.8725220
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106