You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLipase 4
Synonyms
  • Triacylglycerol lipase 4
Gene NameTGL4
Enzyme Class
Biological Properties
General FunctionInvolved in metabolic process
Specific FunctionReleases specific fatty acids from neutral lipid triacylglycerols (TAG) thereby supplying fatty acids to a general acylation process. May have a specific role in sporulation
Cellular LocationLipid droplet. Membrane; Multi-pass membrane protein.
SMPDB Pathways
Cardiolipin BiosynthesisPW002431 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/28:0)PW003484 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/30:0)PW003501 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/26:0)PW003502 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/28:0)PW003503 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Ether lipid metabolismec00565 Map00565
Glycerolipid metabolismec00561 Map00561
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
oleoyl-CoA + 1-oleyl-2-lyso-phosphatidateCoenzyme A + PA(18:1(9Z)/18:1(9Z))
PA(16:0/0:0) + Palmityl-CoACoenzyme A + PA(16:0/16:0)
PA(16:0/0:0) + Palmityl-CoADG(16:0/16:0/0:0) + Coenzyme A
PA(16:0/0:0) + Palmitic acidPA(16:0/16:0) + Coenzyme A
PA(16:0/0:0) + Palmityl-CoA Coenzyme A + PA(16:0/16:0)
KEGG Reactions
DG(16:0/16:0/0:0) + fatty acid ↔ TG(18:0/18:0/18:0) + water
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00069Palmitic acidShow
YMDB00301Palmityl-CoAShow
YMDB00539oleoyl-CoAShow
YMDB00679myristic acidShow
YMDB00809TG(16:0/16:0/16:0)Show
YMDB00825TrimyristinShow
YMDB008341,3-DipalmitinShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB01096TG(18:0/18:0/18:0)Show
YMDB01127DG(16:0/16:0/0:0)Show
YMDB01160PA(16:0/0:0)Show
YMDB01161PA(16:0/16:0)Show
YMDB01260TG(12:0/12:0/18:1(9Z))Show
YMDB01261TG(12:0/14:0/16:0)Show
YMDB01262TG(12:0/14:0/16:1(9Z))Show
YMDB01263TG(12:0/14:1(9Z)/16:1(9Z))Show
YMDB01265TG(12:0/16:0/16:0)Show
YMDB01266TG(12:0/16:0/16:1(9Z))Show
YMDB01267TG(12:0/16:0/18:1(9Z))Show
YMDB01268TG(12:0/16:1(9Z)/16:1(9Z))Show
YMDB01269TG(12:0/16:1(9Z)/18:1(9Z))Show
YMDB01271TG(14:0/16:0/16:0)Show
YMDB01272TG(14:0/16:0/16:1(9Z))Show
YMDB01274TG(14:0/16:1(9Z)/16:1(9Z))Show
YMDB01285TG(16:0/16:0/18:0)Show
YMDB12737DG(14:0/14:0/0:0)Show
YMDB15588TG(10:0/10:0/10:0)Show
YMDB15589TG(10:0/10:0/12:0)Show
YMDB15590TG(10:0/10:0/14:0)Show
YMDB15591TG(10:0/12:0/12:0)Show
YMDB15592TG(10:0/10:0/14:1(9Z))Show
YMDB15593TG(10:0/10:0/16:0)Show
YMDB15594TG(10:0/12:0/14:0)Show
YMDB15595TG(12:0/12:0/12:0)Show
YMDB15596TG(10:0/10:0/16:1(9Z))Show
YMDB15597TG(10:0/12:0/14:1(9Z))Show
YMDB15598TG(10:0/10:0/18:0)Show
YMDB15599TG(10:0/12:0/16:0)Show
YMDB15600TG(10:0/14:0/14:0)Show
YMDB15601TG(12:0/12:0/14:0)Show
YMDB15602TG(10:0/10:0/18:1(9Z))Show
YMDB15603TG(10:0/12:0/16:1(9Z))Show
YMDB15604TG(10:0/14:0/14:1(9Z))Show
YMDB15605TG(12:0/12:0/14:1(9Z))Show
YMDB15606TG(10:0/10:0/20:0)Show
YMDB15607TG(10:0/12:0/18:0)Show
YMDB15608TG(10:0/14:0/16:0)Show
YMDB15609TG(10:0/15:0/15:0)Show
YMDB15610TG(12:0/12:0/16:0)Show
YMDB15611TG(12:0/14:0/14:0)Show
YMDB15612TG(10:0/10:0/20:1(13Z))Show
YMDB15613TG(10:0/12:0/18:1(9Z))Show
YMDB15614TG(10:0/14:0/16:1(9Z))Show
YMDB15615TG(10:0/14:1(9Z)/16:0)Show
YMDB15616TG(10:0/15:0/15:1(9Z))Show
YMDB15617TG(12:0/12:0/16:1(9Z))Show
YMDB15618TG(12:0/14:0/14:1(9Z))Show
YMDB15619TG(10:0/14:1(9Z)/16:1(9Z))Show
YMDB15620TG(10:0/15:1(9Z)/15:1(9Z))Show
YMDB15621TG(12:0/14:1(9Z)/14:1(9Z))Show
YMDB15622TG(10:0/10:0/22:0)Show
YMDB15623TG(10:0/12:0/20:0)Show
YMDB15624TG(10:0/14:0/18:0)Show
YMDB15625TG(10:0/16:0/16:0)Show
YMDB15626TG(12:0/12:0/18:0)Show
YMDB15627TG(12:0/15:0/15:0)Show
YMDB15629TG(10:0/10:0/22:1(13Z))Show
YMDB15630TG(10:0/12:0/20:1(13Z))Show
YMDB15631TG(10:0/14:0/18:1(9Z))Show
YMDB15632TG(10:0/14:1(9Z)/18:0)Show
YMDB15633TG(10:0/16:0/16:1(9Z))Show
YMDB15634TG(12:0/14:1(9Z)/16:0)Show
YMDB15635TG(12:0/15:0/15:1(9Z))Show
YMDB15636TG(14:0/14:0/14:1(9Z))Show
YMDB15637TG(10:0/14:1(9Z)/18:1(9Z))Show
YMDB15638TG(10:0/16:1(9Z)/16:1(9Z))Show
YMDB15639TG(12:0/15:1(9Z)/15:1(9Z))Show
YMDB15640TG(14:0/14:1(9Z)/14:1(9Z))Show
YMDB15641TG(14:1(9Z)/14:1(9Z)/14:1(9Z))Show
YMDB15642TG(10:0/15:0/18:0)Show
YMDB15643TG(12:0/15:0/16:0)Show
YMDB15644TG(14:0/14:0/15:0)Show
YMDB15645TG(10:0/10:0/23:1(9Z))Show
YMDB15646TG(10:0/15:0/18:1(9Z))Show
YMDB15647TG(10:0/15:1(9Z)/18:0)Show
YMDB15648TG(12:0/15:0/16:1(9Z))Show
YMDB15649TG(12:0/15:1(9Z)/16:0)Show
YMDB15650TG(14:0/14:0/15:1(9Z))Show
YMDB15651TG(14:0/14:1(9Z)/15:0)Show
YMDB15652TG(10:0/15:1(9Z)/18:1(9Z))Show
YMDB15653TG(12:0/15:1(9Z)/16:1(9Z))Show
YMDB15654TG(14:0/14:1(9Z)/15:1(9Z))Show
YMDB15655TG(14:1(9Z)/14:1(9Z)/15:0)Show
YMDB15656TG(10:0/10:0/24:0)Show
YMDB15657TG(10:0/12:0/22:0)Show
YMDB15658TG(10:0/14:0/20:0)Show
YMDB15659TG(10:0/16:0/18:0)Show
YMDB15660TG(12:0/12:0/20:0)Show
YMDB15661TG(12:0/14:0/18:0)Show
YMDB15662TG(14:0/14:0/16:0)Show
YMDB15663TG(14:0/15:0/15:0)Show
YMDB15664TG(10:0/10:0/24:1(15Z))Show
YMDB15665TG(10:0/12:0/22:1(13Z))Show
YMDB15666TG(10:0/14:0/20:1(13Z))Show
YMDB15667TG(10:0/14:1(9Z)/20:0)Show
YMDB15668TG(10:0/16:0/18:1(9Z))Show
YMDB15669TG(10:0/16:1(9Z)/18:0)Show
YMDB15670TG(12:0/12:0/20:1(13Z))Show
YMDB15671TG(12:0/14:0/18:1(9Z))Show
YMDB15672TG(12:0/14:1(9Z)/18:0)Show
YMDB15673TG(14:0/14:0/16:1(9Z))Show
YMDB15674TG(14:0/14:1(9Z)/16:0)Show
YMDB15675TG(14:0/15:0/15:1(9Z))Show
YMDB15676TG(14:1(9Z)/15:0/15:0)Show
YMDB15677TG(10:0/14:1(9Z)/20:1(13Z))Show
YMDB15678TG(10:0/16:1(9Z)/18:1(9Z))Show
YMDB15679TG(12:0/14:1(9Z)/18:1(9Z))Show
YMDB15680TG(14:0/14:1(9Z)/16:1(9Z))Show
YMDB15681TG(14:0/15:1(9Z)/15:1(9Z))Show
YMDB15682TG(14:1(9Z)/14:1(9Z)/16:0)Show
YMDB15683TG(14:1(9Z)/15:0/15:1(9Z))Show
YMDB15684TG(10:0/10:0/25:0)Show
YMDB15685TG(10:0/15:0/20:0)Show
YMDB15686TG(12:0/15:0/18:0)Show
YMDB15687TG(14:0/15:0/16:0)Show
YMDB15688TG(15:0/15:0/15:0)Show
YMDB15689TG(10:0/10:0/25:1(15Z))Show
YMDB15690TG(10:0/12:0/23:1(9Z))Show
YMDB15691TG(10:0/15:0/20:1(13Z))Show
YMDB15692TG(10:0/15:1(9Z)/20:0)Show
YMDB15693TG(12:0/15:0/18:1(9Z))Show
YMDB15694TG(12:0/15:1(9Z)/18:0)Show
YMDB15695TG(14:0/15:0/16:1(9Z))Show
YMDB15696TG(14:0/15:1(9Z)/16:0)Show
YMDB15697TG(14:1(9Z)/15:0/16:0)Show
YMDB15698TG(15:0/15:0/15:1(9Z))Show
YMDB15699TG(10:0/15:1(9Z)/20:1(13Z))Show
YMDB15700TG(12:0/15:1(9Z)/18:1(9Z))Show
YMDB15701TG(14:0/15:1(9Z)/16:1(9Z))Show
YMDB15702TG(14:1(9Z)/15:0/16:1(9Z))Show
YMDB15703TG(14:1(9Z)/15:1(9Z)/16:0)Show
YMDB15704TG(15:0/15:1(9Z)/15:1(9Z))Show
YMDB15705TG(14:1(9Z)/15:1(9Z)/16:1(9Z))Show
YMDB15706TG(15:1(9Z)/15:1(9Z)/15:1(9Z))Show
YMDB15707TG(10:0/10:0/26:0)Show
YMDB15708TG(10:0/12:0/24:0)Show
YMDB15709TG(10:0/14:0/22:0)Show
YMDB15710TG(10:0/16:0/20:0)Show
YMDB15711TG(10:0/18:0/18:0)Show
YMDB15712TG(12:0/12:0/22:0)Show
YMDB15713TG(12:0/14:0/20:0)Show
YMDB15714TG(12:0/16:0/18:0)Show
YMDB15715TG(14:0/14:0/18:0)Show
YMDB15716TG(15:0/15:0/16:0)Show
YMDB15717TG(10:0/10:0/26:1(5Z))Show
YMDB15718TG(10:0/12:0/24:1(15Z))Show
YMDB15719TG(10:0/14:0/22:1(13Z))Show
YMDB15720TG(10:0/14:1(9Z)/22:0)Show
YMDB15721TG(10:0/16:0/20:1(13Z))Show
YMDB15722TG(10:0/16:1(9Z)/20:0)Show
YMDB15723TG(10:0/18:0/18:1(9Z))Show
YMDB15724TG(12:0/12:0/22:1(13Z))Show
YMDB15725TG(12:0/14:0/20:1(13Z))Show
YMDB15726TG(12:0/14:1(9Z)/20:0)Show
YMDB15727TG(12:0/16:1(9Z)/18:0)Show
YMDB15728TG(14:0/14:0/18:1(9Z))Show
YMDB15729TG(14:0/14:1(9Z)/18:0)Show
YMDB15730TG(14:1(9Z)/16:0/16:0)Show
YMDB15731TG(15:0/15:0/16:1(9Z))Show
YMDB15732TG(15:0/15:1(9Z)/16:0)Show
YMDB15733TG(10:0/14:1(9Z)/22:1(13Z))Show
YMDB15734TG(10:0/16:1(9Z)/20:1(13Z))Show
YMDB15735TG(10:0/18:1(9Z)/18:1(9Z))Show
YMDB15736TG(12:0/14:1(9Z)/20:1(13Z))Show
YMDB15737TG(14:0/14:1(9Z)/18:1(9Z))Show
YMDB15738TG(14:1(9Z)/14:1(9Z)/18:0)Show
YMDB15739TG(14:1(9Z)/16:0/16:1(9Z))Show
YMDB15740TG(15:0/15:1(9Z)/16:1(9Z))Show
YMDB15741TG(15:1(9Z)/15:1(9Z)/16:0)Show
YMDB15742TG(10:0/10:0/27:0)Show
YMDB15743TG(10:0/12:0/25:0)Show
YMDB15744TG(10:0/15:0/22:0)Show
YMDB15745TG(12:0/15:0/20:0)Show
YMDB15746TG(14:0/15:0/18:0)Show
YMDB15747TG(15:0/16:0/16:0)Show
YMDB15748TG(10:0/10:0/28:0)Show
YMDB15749TG(10:0/12:0/26:0)Show
YMDB15750TG(10:0/14:0/24:0)Show
YMDB15751TG(10:0/16:0/22:0)Show
YMDB15752TG(10:0/18:0/20:0)Show
YMDB15753TG(12:0/12:0/24:0)Show
YMDB15754TG(12:0/14:0/22:0)Show
YMDB15755TG(12:0/16:0/20:0)Show
YMDB15756TG(12:0/18:0/18:0)Show
YMDB15757TG(14:0/14:0/20:0)Show
YMDB15758TG(14:0/16:0/18:0)Show
YMDB15759TG(15:0/15:0/18:0)Show
YMDB15760TG(10:0/10:0/29:0)Show
YMDB15761TG(10:0/12:0/27:0)Show
YMDB15762TG(10:0/14:0/25:0)Show
YMDB15763TG(10:0/15:0/24:0)Show
YMDB15764TG(12:0/12:0/25:0)Show
YMDB15765TG(12:0/15:0/22:0)Show
YMDB15766TG(14:0/15:0/20:0)Show
YMDB15767TG(15:0/16:0/18:0)Show
YMDB15768TG(10:0/10:0/30:0)Show
YMDB15769TG(10:0/12:0/28:0)Show
YMDB15770TG(10:0/14:0/26:0)Show
YMDB15771TG(10:0/15:0/25:0)Show
YMDB15772TG(10:0/16:0/24:0)Show
YMDB15773TG(10:0/18:0/22:0)Show
YMDB15774TG(10:0/20:0/20:0)Show
YMDB15775TG(12:0/12:0/26:0)Show
YMDB15776TG(12:0/14:0/24:0)Show
YMDB15777TG(12:0/16:0/22:0)Show
YMDB15778TG(12:0/18:0/20:0)Show
YMDB15779TG(14:0/14:0/22:0)Show
YMDB15780TG(14:0/16:0/20:0)Show
YMDB15781TG(14:0/18:0/18:0)Show
YMDB15782TG(15:0/15:0/20:0)Show
YMDB15783TG(10:0/12:0/29:0)Show
YMDB15784TG(10:0/14:0/27:0)Show
YMDB15785TG(10:0/15:0/26:0)Show
YMDB15786TG(10:0/16:0/25:0)Show
YMDB15787TG(12:0/12:0/27:0)Show
YMDB15788TG(12:0/14:0/25:0)Show
YMDB15789TG(12:0/15:0/24:0)Show
YMDB15790TG(14:0/15:0/22:0)Show
YMDB15791TG(15:0/16:0/20:0)Show
YMDB15792TG(15:0/18:0/18:0)Show
YMDB15793TG(10:0/12:0/30:0)Show
YMDB15794TG(10:0/14:0/28:0)Show
YMDB15795TG(10:0/15:0/27:0)Show
YMDB15796TG(10:0/16:0/26:0)Show
YMDB15797TG(10:0/18:0/24:0)Show
YMDB15798TG(10:0/20:0/22:0)Show
YMDB15799TG(12:0/12:0/28:0)Show
YMDB15800TG(12:0/14:0/26:0)Show
YMDB15801TG(12:0/15:0/25:0)Show
YMDB15802TG(12:0/16:0/24:0)Show
YMDB15803TG(12:0/18:0/22:0)Show
YMDB15804TG(12:0/20:0/20:0)Show
YMDB15805TG(14:0/14:0/24:0)Show
YMDB15806TG(14:0/16:0/22:0)Show
YMDB15807TG(14:0/18:0/20:0)Show
YMDB15808TG(15:0/15:0/22:0)Show
YMDB15809TG(16:0/16:0/20:0)Show
YMDB15810TG(16:0/18:0/18:0)Show
YMDB15811TG(10:0/14:0/29:0)Show
YMDB15812TG(10:0/15:0/28:0)Show
YMDB15813TG(10:0/16:0/27:0)Show
YMDB15814TG(10:0/18:0/25:0)Show
YMDB15815TG(12:0/12:0/29:0)Show
YMDB15816TG(12:0/14:0/27:0)Show
YMDB15817TG(12:0/15:0/26:0)Show
YMDB15818TG(12:0/16:0/25:0)Show
YMDB15819TG(14:0/14:0/25:0)Show
YMDB15820TG(14:0/15:0/24:0)Show
YMDB15821TG(15:0/16:0/22:0)Show
YMDB15822TG(15:0/18:0/20:0)Show
YMDB15823TG(10:0/14:0/30:0)Show
YMDB15824TG(10:0/15:0/29:0)Show
YMDB15825TG(10:0/16:0/28:0)Show
YMDB15826TG(10:0/18:0/26:0)Show
YMDB15827TG(10:0/20:0/24:0)Show
YMDB15828TG(10:0/22:0/22:0)Show
YMDB15829TG(12:0/12:0/30:0)Show
YMDB15830TG(12:0/14:0/28:0)Show
YMDB15831TG(12:0/15:0/27:0)Show
YMDB15832TG(12:0/16:0/26:0)Show
YMDB15833TG(12:0/18:0/24:0)Show
YMDB15834TG(12:0/20:0/22:0)Show
YMDB15835TG(14:0/14:0/26:0)Show
YMDB15836TG(14:0/15:0/25:0)Show
YMDB15837TG(14:0/16:0/24:0)Show
YMDB15838TG(14:0/18:0/22:0)Show
YMDB15839TG(14:0/20:0/20:0)Show
YMDB15840TG(15:0/15:0/24:0)Show
YMDB15841TG(16:0/16:0/22:0)Show
YMDB15842TG(16:0/18:0/20:0)Show
YMDB15843TG(10:0/15:0/30:0)Show
YMDB15844TG(10:0/16:0/29:0)Show
YMDB15845TG(10:0/18:0/27:0)Show
YMDB15846TG(10:0/20:0/25:0)Show
YMDB15847TG(12:0/14:0/29:0)Show
YMDB15848TG(12:0/15:0/28:0)Show
YMDB15849TG(12:0/16:0/27:0)Show
YMDB15850TG(12:0/18:0/25:0)Show
YMDB15851TG(14:0/14:0/27:0)Show
YMDB15852TG(14:0/15:0/26:0)Show
YMDB15853TG(14:0/16:0/25:0)Show
YMDB15854TG(15:0/15:0/25:0)Show
YMDB15855TG(15:0/16:0/24:0)Show
YMDB15856TG(15:0/18:0/22:0)Show
YMDB15857TG(15:0/20:0/20:0)Show
YMDB15858TG(10:0/16:0/30:0)Show
YMDB15859TG(10:0/18:0/28:0)Show
YMDB15860TG(10:0/20:0/26:0)Show
YMDB15861TG(10:0/22:0/24:0)Show
YMDB15862TG(12:0/14:0/30:0)Show
YMDB15863TG(12:0/15:0/29:0)Show
YMDB15864TG(12:0/16:0/28:0)Show
YMDB15865TG(12:0/18:0/26:0)Show
YMDB15866TG(12:0/20:0/24:0)Show
YMDB15867TG(12:0/22:0/22:0)Show
YMDB15868TG(14:0/14:0/28:0)Show
YMDB15869TG(14:0/15:0/27:0)Show
YMDB15870TG(14:0/16:0/26:0)Show
YMDB15871TG(14:0/18:0/24:0)Show
YMDB15872TG(14:0/20:0/22:0)Show
YMDB15873TG(15:0/15:0/26:0)Show
YMDB15874TG(15:0/16:0/25:0)Show
YMDB15875TG(16:0/16:0/24:0)Show
YMDB15876TG(16:0/18:0/22:0)Show
YMDB15877TG(16:0/20:0/20:0)Show
YMDB15878TG(18:0/18:0/20:0)Show
YMDB15879TG(10:0/18:0/29:0)Show
YMDB15880TG(10:0/20:0/27:0)Show
YMDB15881TG(10:0/22:0/25:0)Show
YMDB15882TG(12:0/15:0/30:0)Show
YMDB15883TG(12:0/16:0/29:0)Show
YMDB15884TG(12:0/18:0/27:0)Show
YMDB15885TG(12:0/20:0/25:0)Show
YMDB15886TG(14:0/14:0/29:0)Show
YMDB15887TG(14:0/15:0/28:0)Show
YMDB15888TG(14:0/16:0/27:0)Show
YMDB15889TG(14:0/18:0/25:0)Show
YMDB15890TG(15:0/15:0/27:0)Show
YMDB15891TG(15:0/16:0/26:0)Show
YMDB15892TG(15:0/18:0/24:0)Show
YMDB15893TG(15:0/20:0/22:0)Show
YMDB15894TG(16:0/16:0/25:0)Show
YMDB163021-oleyl-2-lyso-phosphatidateShow
YMDB16329Lyso-PAF C-16Show
YMDB163301-O-Palmityl-2-palmitoyl-rac-glycero-3-phosphocholineShow
GO Classification
Component
Not Available
Function
binding
nucleotide binding
purine nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
GTP binding
Process
lipid metabolic process
metabolic process
primary metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKR089C
Gene Sequence>2733 bp ATGAGCAGCAAAATATCAGATCTTACATCTACACAAAATAAGCCCCTCCTTGTTACGCAA CAACTAATCGAAAAATATTACGAACAGATCCTGGGCACTTCCCAGAACATAATTCCTATT TTAAATCCGAAGAACAAGTTTATTAGGCCCAGTAAGGATAATTCAGATGTTGAAAGGGTG GAGGAGGATGCTGGTAAAAGACTGCAAACTGGCAAGAACAAAACTACGAACAAAGTAAAT TTCAACCTGGATACTGGAAACGAGGATAAACTTGACGATGACCAAGAGACAGTAACAGAA AATGAAAATAATGATATCGAGATGGTTGAGACAGACGAAGGCGAAGATGAAAGGCAAGGG TCATCTTTAGCCAGTAAATGCAAATCATTTCTTTACAACGTTTTTGTGGGAAACTATGAA AGAGACATTCTTATTGACAAAGTCTGTTCACAAAAGCAACATGCGATGTCATTTGAAGAA TGGTGTTCTGCGGGCGCCAGATTGGATGACCTCACTGGGAAAACAGAATGGAAGCAGAAA TTGGAAAGTCCCTTGTATGATTACAAGCTAATAAAAGATTTAACATCTAGAATGCGTGAG GAGCGCTTGAATAGGAATTACGCTCAATTGTTGTACATCATTAGGACGAATTGGGTACGA AACCTGGGAAATATGGGGAATGTAAACCTATATAGGCACTCCCATGTAGGCACCAAATAT TTAATTGACGAGTATATGATGGAGTCTAGGTTAGCGCTAGAATCTTTAATGGAGTCTGAT CTTGATGATAGTTACCTTTTGGGTATACTGCAACAAACGAGAAGAAATATTGGTCGTACC GCTTTAGTTCTCAGTGGGGGTGGAACTTTTGGTCTTTTCCACATCGGTGTCCTTGGTACT CTATTTGAATTGGATTTATTACCCAGAGTGATTAGTGGTAGCAGTGCTGGTGCAATTGTA GCAAGCATATTATCTGTCCATCACAAAGAAGAAATTCCGGTTTTACTAAATCATATTTTG GATAAAGAATTCAACATTTTCAAAGACGATAAACAGAAAAGTGAAAGCGAGAATTTGTTA ATAAAAATATCTAGGTTCTTCAAAAACGGTACGTGGTTTGATAACAAGCATCTGGTAAAT ACAATGATAGAATTTTTGGGAGATTTGACATTTAGGGAAGCTTACAATAGAACGGGTAAA ATTTTGAATATAACCGTTTCGCCGGCATCTTTATTTGAACAACCGCGCTTGCTGAATAAT TTGACTGCACCAAACGTCCTGATTTGGTCCGCCGTATGTGCATCATGTTCACTACCGGGA ATTTTCCCCTCGAGCCCACTTTACGAAAAAGATCCAAAAACGGGAGAAAGGAAACCATGG ACTGGTAGTAGTTCGGTCAAATTTGTCGATGGTTCTGTGGACAATGACTTGCCCATTTCT CGTCTTTCTGAAATGTTTAATGTAGACCATATTATCGCATGCCAGGTGAATATTCACGTA TTTCCCTTTTTGAAACTATCACTATCCTGTGTTGGCGGGGAAATTGAGGACGAATTTAGT GCAAGATTAAAGCAAAACTTATCAAGTATATACAATTTTATGGCCAATGAAGCTATTCAT ATTCTAGAAATTGGAAGTGAGATGGGAATTGCCAAAAACGCGCTTACAAAACTGAGATCG GTATTATCTCAACAATATTCTGGTGACATCACTATTTTGCCCGACATGTGTATGCTTTTT AGAATAAAGGAGCTGTTGTCAAACCCAACAAAAGAATTTTTATTAAGGGAAATCACCAAT GGTGCAAAAGCTACGTGGCCCAAGGTTTCCATTATTCAAAATCACTGTGGCCAGGAATTT GCTCTGGATAAGGCGATTTCTTATATCAAAGGTAGGATGATTGTCACCTCCTCTTTAAAA ACCCCCTTCCAATTTGCTGATTCAGTCATTGGATTAATTAAAGCTCCAGAGCAAACGTCA GATGAGTCCAAAAACCCAGAAAATTCAACATTGCTAACTAGGACTCCAACCAAGGGTGAC AATCATATTTCCAATGTTTTAGATGACAACTTATTAGAATCAGAATCGACAAACTCTTTG CTATTGTTACGTGAGAATGCAAGCACATATGGGCGGTCACCTTCCGGGTTTAGACCGCGG TATTCCATTACGTCCGCTTCTCTCAATCCGCGTCACCAAAGAAGGAAATCAGATACTATT TCAACTTCAAGGCGACCAGCCAAATCCTTTTCATTTTCAGTTGCTTCTCCCACATCAAGG ATGTTGAGGCAATCCAGCAAAATCAATGGACACCCACCGCCAATTCTGCAGAAAAAAACA AGTATGGGCCGGCTAATGTTTCCTATGGATGCCAAGACCTATGACCCGGAAAGCCATGAA CTTATCCCACATTCTGCCAGCATTGAAACACCTGCCATGGTAGACAAGAAATTGCATTTT GGCCGAAAGAGTAGATACTTGAGGCATATGAACAAAAAATGGGTCAGCAGTAGCAACATA TTATACACAGATTCGGATAAAGAAGACCATCCTACATTGAGACTGATAAGTAACTTCGAT TCAGACGCAATGATTCATAGTGATTTAGCGGGCAATTTCAGGCGTCATAGCATTGATGGA AGACCCCCTTCTCAAGCTACAAAGAGCTCACCGTTTCGATCGAGGCCTTCTTCTTCAACG CAGCACAAAAGCACCACCAGTTTTACTCAATAA
Protein Properties
Pfam Domain Function
Protein Residues910
Protein Molecular Weight102716.0
Protein Theoretical pI8.16
Signalling Regions
  • None
Transmembrane Regions
  • 282-302
  • 310-326
  • 426-442
Protein Sequence>Lipase 4 MSSKISDLTSTQNKPLLVTQQLIEKYYEQILGTSQNIIPILNPKNKFIRPSKDNSDVERV EEDAGKRLQTGKNKTTNKVNFNLDTGNEDKLDDDQETVTENENNDIEMVETDEGEDERQG SSLASKCKSFLYNVFVGNYERDILIDKVCSQKQHAMSFEEWCSAGARLDDLTGKTEWKQK LESPLYDYKLIKDLTSRMREERLNRNYAQLLYIIRTNWVRNLGNMGNVNLYRHSHVGTKY LIDEYMMESRLALESLMESDLDDSYLLGILQQTRRNIGRTALVLSGGGTFGLFHIGVLGT LFELDLLPRVISGSSAGAIVASILSVHHKEEIPVLLNHILDKEFNIFKDDKQKSESENLL IKISRFFKNGTWFDNKHLVNTMIEFLGDLTFREAYNRTGKILNITVSPASLFEQPRLLNN LTAPNVLIWSAVCASCSLPGIFPSSPLYEKDPKTGERKPWTGSSSVKFVDGSVDNDLPIS RLSEMFNVDHIIACQVNIHVFPFLKLSLSCVGGEIEDEFSARLKQNLSSIYNFMANEAIH ILEIGSEMGIAKNALTKLRSVLSQQYSGDITILPDMCMLFRIKELLSNPTKEFLLREITN GAKATWPKVSIIQNHCGQEFALDKAISYIKGRMIVTSSLKTPFQFADSVIGLIKAPEQTS DESKNPENSTLLTRTPTKGDNHISNVLDDNLLESESTNSLLLLRENASTYGRSPSGFRPR YSITSASLNPRHQRRKSDTISTSRRPAKSFSFSVASPTSRMLRQSSKINGHPPPILQKKT SMGRLMFPMDAKTYDPESHELIPHSASIETPAMVDKKLHFGRKSRYLRHMNKKWVSSSNI LYTDSDKEDHPTLRLISNFDSDAMIHSDLAGNFRRHSIDGRPPSQATKSSPFRSRPSSST QHKSTTSFTQ
References
External Links
ResourceLink
Saccharomyces Genome Database TGL4
Uniprot IDP36165
Uniprot NameTGL4_YEAST
GenBank Gene IDZ27116
Genebank Protein ID415909
General Reference
  • Garcia-Cantalejo, J., Baladron, V., Esteban, P. F., Santos, M. A., Bou, G., Remacha, M. A., Revuelta, J. L., Ballesta, J. P., Jimenez, A., del Rey, F. (1994). "The complete sequence of an 18,002 bp segment of Saccharomyces cerevisiae chromosome XI contains the HBS1, MRP-L20 and PRP16 genes, and six new open reading frames." Yeast 10:231-245.8203164
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Athenstaedt, K., Daum, G. (2005). "Tgl4p and Tgl5p, two triacylglycerol lipases of the yeast Saccharomyces cerevisiae are localized to lipid particles." J Biol Chem 280:37301-37309.16135509
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956