You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutathione S-transferase omega-like 2
Synonyms
  • Extracellular mutant protein 4
Gene NameECM4
Enzyme Class
Biological Properties
General FunctionPosttranslational modification, protein turnover, chaperones
Specific FunctionActive as '1-Cys' thiol transferase against beta- hydroxyethyl disulfide (HED), as dehydroascorbate reductase and as dimethylarsinic acid reductase, while not active against the standard GST substrate 1-chloro-2,4-dinitrobenzene (CDNB). May be involved in cell wall organization and biogenesis
Cellular LocationCytoplasm
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glutathione metabolismec00480 Map00480
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00160GlutathioneShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 11
LocusYKR076W
Gene Sequence>1113 bp ATGTCGAAACAGTGGGCGAGTGGTACAAACGGAGCTTTCAAAAGACAGGTTTCGTCCTTC AGAGAAACAATCTCTAAGCAACACCCAATTTATAAGCCAGCAAAGGGAAGATATTGGTTG TATGTTTCACTTGCATGCCCATGGGCCCATAGAACACTAATTACGAGGGCTTTGAAGGGA TTAACCTCTGTTATAGGATGTAGCGTAGTCCATTGGCACCTTGACGAGAAAGGATGGAGA TTTTTGGACATGGAAAAGCAATTGGAGGACAGTGAAGATTTTTTGGAACATTGGCACGAT GTTGCAGGTGGTATTAGAACTGCTAAAGAGGATTCCAGCAAGAGCTTCGCCGAGATCAAG AATGACAGTCAAAGATTCATGGTTGATGCTACCAATGAGCCTCACTATGGATACAAGAGA ATCAGTGACTTATATTACAAGAGCGATCCTCAATACTCGGCAAGGTTCACCGTCCCAGTC CTGTGGGACTTAGAAACCCAAACAATTGTTAACAACGAAAGTAGCGAAATTATAAGGATT TTGAACTCTAGTGCGTTCGATGAATTTGTCGACGACGATCACAAGAAAACGGACCTTGTT CCTGCTCAGTTGAAAACACAGATCGATGACTTCAATTCTTGGGTTTACGACAGCATCAAC AATGGTGTATACAAGACCGGATTCGCAGAGAAAGCAGAAGTTTACGAAAGTGAAGTCAAC AACGTATTTGAACATTTGGACAAAGTGGAGAAAATCCTGAGTGACAAATATTCCAAATTG AAGGCCAAATACGGTGAAGAAGATAGACAAAAAATCTTGGGTGAGTTCTTCACTGTGGGT GATCAATTAACAGAAGCTGACATTAGATTGTATACTACCGTCATAAGATTCGATCCTGTG TACGTCCAACATTTCAAATGCAATTTTACCTCTATTAGAGCCGGATATCCATTTATTCAT TTGTGGGTAAGAAATTTATACTGGAATTATGATGCCTTCAGGTACACAACAGATTTTGAC CATATCAAGTTACACTACACGCGTTCCCACACAAGGATCAACCCCTTGGGAATTACGCCC CTGGGACCCAAGCCAGATATTCGTCCTTTATAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues370
Protein Molecular Weight43273.39844
Protein Theoretical pI6.89
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutathione S-transferase omega-like 2 MSKQWASGTNGAFKRQVSSFRETISKQHPIYKPAKGRYWLYVSLACPWAHRTLITRALKG LTSVIGCSVVHWHLDEKGWRFLDMEKQLEDSEDFLEHWHDVAGGIRTAKEDSSKSFAEIK NDSQRFMVDATNEPHYGYKRISDLYYKSDPQYSARFTVPVLWDLETQTIVNNESSEIIRI LNSSAFDEFVDDDHKKTDLVPAQLKTQIDDFNSWVYDSINNGVYKTGFAEKAEVYESEVN NVFEHLDKVEKILSDKYSKLKAKYGEEDRQKILGEFFTVGDQLTEADIRLYTTVIRFDPV YVQHFKCNFTSIRAGYPFIHLWVRNLYWNYDAFRYTTDFDHIKLHYTRSHTRINPLGITP LGPKPDIRPL
References
External Links
ResourceLink
Saccharomyces Genome Database ECM4
Uniprot IDP36156
Uniprot NameGTO2_YEAST
GenBank Gene IDZ28301
Genebank Protein ID486551
General Reference
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Lussier, M., White, A. M., Sheraton, J., di Paolo, T., Treadwell, J., Southard, S. B., Horenstein, C. I., Chen-Weiner, J., Ram, A. F., Kapteyn, J. C., Roemer, T. W., Vo, D. H., Bondoc, D. C., Hall, J., Zhong, W. W., Sdicu, A. M., Davies, J., Klis, F. M., Robbins, P. W., Bussey, H. (1997). "Large scale identification of genes involved in cell surface biosynthesis and architecture in Saccharomyces cerevisiae." Genetics 147:435-450.9335584
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Garcera, A., Barreto, L., Piedrafita, L., Tamarit, J., Herrero, E. (2006). "Saccharomyces cerevisiae cells have three Omega class glutathione S-transferases acting as 1-Cys thiol transferases." Biochem J 398:187-196.16709151
  • Barreto, L., Garcera, A., Jansson, K., Sunnerhagen, P., Herrero, E. (2006). "A peroxisomal glutathione transferase of Saccharomyces cerevisiae is functionally related to sulfur amino acid metabolism." Eukaryot Cell 5:1748-1759.16936141