You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUroporphyrinogen-III C-methyltransferase
Synonyms
  • Urogen III methylase
  • SUMT
  • Uroporphyrinogen III methylase
  • UROM
Gene NameMET1
Enzyme Class
Biological Properties
General FunctionInvolved in methyltransferase activity
Specific FunctionSiroheme synthase involved in methionine biosynthesis
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Porphyrin and chlorophyll metabolismec00860 Map00860
SMPDB ReactionsNot Available
KEGG Reactions
Uroporphyrinogen III + S-AdenosylmethioninePrecorrin-2 + S-Adenosylhomocysteine + hydron
Metabolites
YMDB IDNameView
YMDB00021precorrin-1Show
YMDB00198S-AdenosylhomocysteineShow
YMDB00267Uroporphyrinogen IIIShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB00862hydronShow
YMDB00977Precorrin-2Show
GO Classification
Component
Not Available
Function
C-methyltransferase activity
uroporphyrin-III C-methyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Process
heme biosynthetic process
siroheme biosynthetic process
tetrapyrrole metabolic process
porphyrin metabolic process
porphyrin biosynthetic process
metabolic process
nitrogen compound metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 11
LocusYKR069W
Gene Sequence>1782 bp ATGGTACGAGACTTAGTGACATTGCCTTCATCACTGCCCTTGATTACTGCTGGTTTTGCT ACTGATCAGGTTCATTTGCTTATTGGTACAGGGTCCACGGACTCAGTAAGCGTTTGTAAG AATAGAATCCACTCCATTTTGAATGCTGGTGGTAATCCCATAGTAGTGAATCCCTCGTCA CCAAGCCATACTAAACAATTACAATTGGAATTTGGTAAGTTTGCAAAGTTCGAAATAGTA GAAAGGGAGTTTAGGTTATCTGATTTAACTACTTTGGGGAGAGTTCTGGTATGCAAGGTA GTGGATAGAGTATTCGTAGATCTACCCATAACACAAAGTCGCCTATGCGAGGAGATCTTT TGGCAATGCCAAAAACTGAGAATTCCCATAAATACATTCCACAAACCAGAGTTTTCTACC TTCAATATGATTCCTACGTGGGTCGACCCAAAAGGAAGTGGTTTACAAATCTCAGTTACT ACGAATGGGAATGGATACATCTTGGCAAACAGGATAAAAAGAGATATAATATCACACTTA CCTCCAAACATATCTGAGGTGGTGATAAACATGGGGTATTTGAAAGACCGTATTATAAAC GAAGACCATAAGGCCTTGTTAGAGGAAAAGTACTACCAGACTGACATGTCATTACCTGGA TTTGGCTACGGCTTAGATGAGGACGGTTGGGAGAGCCATAAGTTTAATAAGCTAATTCGT GAATTTGAAATGACCAGTAGAGAACAGAGACTTAAGAGAACCAGATGGTTATCTCAGATA ATGGAGTATTACCCGATGAACAAGCTGAGTGACATCAAGTTGGAAGATTTCGAGACTTCA TCTTCTCCAAATAAAAAGACAAAGCAGGAAACTGTCACAGAGGGTGTAGTACCTCCTACC GATGAAAATATTGAAAACGGTACAAAACAACTACAATTATCGGAAGTGAAAAAAGAGGAG GGACCTAAAAAACTAGGGAAGATTTCTTTAGTCGGAAGTGGTCCAGGCTCGGTATCTATG CTAACGATAGGTGCATTACAAGAAATAAAGTCTGCAGATATAATACTGGCAGATAAACTG GTACCGCAAGCCATTTTAGATTTAATACCTCCAAAAACTGAAACCTTCATAGCCAAAAAA TTTCCCGGTAATGCAGAACGAGCACAACAGGAATTACTAGCTAAAGGTTTAGAATCGTTG GATAATGGATTGAAAGTAGTCCGTTTGAAGCAAGGTGATCCGTATATTTTTGGCCGTGGT GGCGAGGAATTTAATTTCTTCAAAGATCACGGATATATTCCTGTGGTTTTACCGGGCATA AGCTCATCCCTAGCTTGTACTGTATTGGCTCAGATACCCGCTACTCAACGTGATATAGCA GACCAAGTGCTCATATGTACTGGGACTGGGAGAAAGGGCGCTCTGCCTATAATTCCTGAA TTTGTTGAAAGCAGAACCACCGTCTTTCTAATGGCACTGCATCGCGCCAACGTTCTGATC ACGGGATTATTGAAGCATGGCTGGGATGGTGATGTCCCCGCTGCAATTGTCGAGAGAGGA TCGTGCCCTGACCAGCGTGTTACTAGAACTCTTCTTAAATGGGTACCAGAAGTCGTGGAG GAGATTGGTTCAAGGCCCCCCGGTGTCTTGGTTGTAGGCAAGGCTGTGAATGCATTGGTT GAAAAAGATCTGATAAATTTTGACGAATCAAGAAAATTTGTCATTGATGAAGGTTTTAGA GAATTTGAGGTTGATGTAGATAGTCTATTTAAGTTATACTAA
Protein Properties
Pfam Domain Function
Protein Residues593
Protein Molecular Weight66124.70313
Protein Theoretical pI6.53
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Uroporphyrinogen-III C-methyltransferase MVRDLVTLPSSLPLITAGFATDQVHLLIGTGSTDSVSVCKNRIHSILNAGGNPIVVNPSS PSHTKQLQLEFGKFAKFEIVEREFRLSDLTTLGRVLVCKVVDRVFVDLPITQSRLCEEIF WQCQKLRIPINTFHKPEFSTFNMIPTWVDPKGSGLQISVTTNGNGYILANRIKRDIISHL PPNISEVVINMGYLKDRIINEDHKALLEEKYYQTDMSLPGFGYGLDEDGWESHKFNKLIR EFEMTSREQRLKRTRWLSQIMEYYPMNKLSDIKLEDFETSSSPNKKTKQETVTEGVVPPT DENIENGTKQLQLSEVKKEEGPKKLGKISLVGSGPGSVSMLTIGALQEIKSADIILADKL VPQAILDLIPPKTETFIAKKFPGNAERAQQELLAKGLESLDNGLKVVRLKQGDPYIFGRG GEEFNFFKDHGYIPVVLPGISSSLACTVLAQIPATQRDIADQVLICTGTGRKGALPIIPE FVESRTTVFLMALHRANVLITGLLKHGWDGDVPAAIVERGSCPDQRVTRTLLKWVPEVVE EIGSRPPGVLVVGKAVNALVEKDLINFDESRKFVIDEGFREFEVDVDSLFKLY
References
External Links
ResourceLink
Saccharomyces Genome Database MET1
Uniprot IDP36150
Uniprot NameSUMT_YEAST
GenBank Gene IDZ28294
Genebank Protein ID486539
General Reference
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Hansen, J., Muldbjerg, M., Cherest, H., Surdin-Kerjan, Y. (1997). "Siroheme biosynthesis in Saccharomyces cerevisiae requires the products of both the MET1 and MET8 genes." FEBS Lett 401:20-24.9003798
  • Raux, E., McVeigh, T., Peters, S. E., Leustek, T., Warren, M. J. (1999). "The role of Saccharomyces cerevisiae Met1p and Met8p in sirohaem and cobalamin biosynthesis." Biochem J 338 ( Pt 3):701-708.10051442
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956