You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycerol-3-phosphate O-acyltransferase 2
Synonyms
  • G-3-P acyltransferase 2
  • Dihydroxyacetone phosphate acyltransferase 2
  • DHAP-AT 2
  • Glycerol-3-phosphate / dihydroxyacetone phosphate acyltransferase 2
Gene NameGPT2
Enzyme Class
Biological Properties
General FunctionInvolved in acyltransferase activity
Specific FunctionG-3-P/dihydroxyacetone phosphate dual substrate-specific sn-1 acyltransferase
Cellular LocationMembrane; Multi-pass membrane protein (Probable)
SMPDB Pathways
Cardiolipin BiosynthesisPW002431 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/28:0)PW003484 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/30:0)PW003501 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/26:0)PW003502 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/28:0)PW003503 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
Glycerol 3-phosphate + oleoyl-CoACoenzyme A + 1-oleyl-2-lyso-phosphatidate
Glycerone phosphate + oleoyl-CoACoenzyme A + 1-oleoyl-2-lyso-glycerone phosphate
Glycerol 3-phosphate + hexadec-2-enoyl-CoACoenzyme A + PA(16:0/0:0)
Glycerone phosphate + Palmityl-CoACoenzyme A + 1-palmitoylglycerone 3-phosphate
Glycerone phosphate + Palmityl-CoACoenzyme A + 1-palmitoylglycerone 3-phosphate
KEGG Reactions
acyl-CoA + Dihydroxyacetone phosphateCoenzyme A + Dihydroxyacetone phosphate acyl ester
acyl-CoA + Glycerol 3-phosphatePA(18:1(9Z)/0:0) + Coenzyme A + hydron
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00073Glycerol 3-phosphateShow
YMDB001871-palmitoylglycerone 3-phosphateShow
YMDB00275Dihydroxyacetone phosphate acyl esterShow
YMDB00301Palmityl-CoAShow
YMDB00322Dihydroxyacetone phosphateShow
YMDB00469hexadec-2-enoyl-CoAShow
YMDB00527palmitoyl-CoAShow
YMDB00539oleoyl-CoAShow
YMDB00862hydronShow
YMDB01160PA(16:0/0:0)Show
YMDB16273Glycerone phosphateShow
YMDB163021-oleyl-2-lyso-phosphatidateShow
YMDB163031-oleoyl-2-lyso-glycerone phosphateShow
GO Classification
Component
Not Available
Function
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKR067W
Gene Sequence>2232 bp ATGTCTGCTCCCGCTGCCGATCATAACGCTGCCAAACCTATTCCTCATGTACCTCAAGCG TCCCGACGGTACAAAAATTCATACAATGGATTCGTATACAATATACATACATGGCTGTAT GATGTGTCTGTATTTCTGTTTAATATTTTGTTCACTATTTTCTTCAGAGAAATTAAGGTA CGTGGTGCATATAACGTTCCCGAAGTTGGGGTGCCAACCATCCTTGTGTGTGCCCCTCAT GCAAATCAGTTCATCGACCCGGCTTTGGTAATGTCGCAAACCCGTTTGCTGAAGACATCA GCGGGAAAGTCCCGATCCAGAATGCCTTGTTTTGTTACTGCTGAGTCGAGTTTTAAGAAA AGATTTATCTCTTTCTTTGGTCACGCAATGGGCGGTATTCCCGTGCCTAGAATTCAGGAC AACTTGAAGCCAGTGGATGAGAATCTTGAGATTTACGCTCCGGACTTGAAGAACCACCCG GAAATCATCAAGGGCCGCTCCAAGAACCCACAGACTACACCAGTGAACTTTACGAAAAGG TTTTCTGCCAAGTCCTTGCTTGGATTGCCCGACTACTTAAGTAATGCTCAAATCAAGGAA ATCCCGGATGATGAAACGATAATCTTGTCCTCTCCATTCAGAACATCGAAATCAAAAGTG GTGGAGCTCTTGACTAATGGTACTAATTTTAAATATGCAGAGAAAATCGACAATACGGAA ACTTTCCAGAGTGTTTTTGATCACTTGCATACGAAGGGCTGTGTAGGTATTTTCCCCGAG GGTGGTTCTCATGACCGTCCTTCGTTACTACCCATCAAGGCAGGTGTTGCCATTATGGCT CTGGGCGCAGTAGCCGCTGATCCTACCATGAAAGTTGCTGTTGTACCCTGTGGTTTGCAT TATTTCCACAGAAATAAATTCAGATCTAGAGCTGTTTTAGAATACGGCGAACCTATAGTG GTGGATGGGAAATATGGCGAAATGTATAAGGACTCCCCACGTGAGACCGTTTCCAAACTA CTAAAAAAGATCACCAATTCTTTGTTTTCTGTTACCGAAAATGCTCCAGATTACGATACT TTGATGGTCATTCAGGCTGCCAGAAGACTATATCAACCGGTAAAAGTCAGGCTACCTTTG CCTGCCATTGTAGAAATCAACAGAAGGTTACTTTTCGGTTATTCCAAGTTTAAAGATGAT CCAAGAATTATTCACTTAAAAAAACTGGTATATGACTACAACAGGAAATTAGATTCAGTG GGTTTAAAAGACCATCAGGTGATGCAATTAAAAACTACCAAATTAGAAGCATTGAGGTGC TTTGTAACTTTGATCGTTCGATTGATTAAATTTTCTGTCTTTGCTATACTATCGTTACCG GGTTCTATTCTCTTCACTCCAATTTTCATTATTTGTCGCGTATACTCAGAAAAGAAGGCC AAAGAGGGTTTAAAGAAATCATTGGTTAAAATTAAGGGTACCGATTTGTTGGCCACATGG AAACTTATCGTGGCGTTAATATTGGCACCAATTTTATACGTTACTTACTCGATCTTGTTG ATTATTTTGGCAAGAAAACAACACTATTGTCGCATCTGGGTTCCTTCCAATAACGCATTC ATACAATTTGTCTATTTTTATGCGTTATTGGTTTTCACCACGTATTCCTCTTTAAAGACC GGTGAAATCGGTGTTGACCTTTTCAAATCTTTAAGACCACTTTTTGTTTCTATTGTTTAC CCCGGTAAGAAGATCGAAGAAATCCAAACAACAAGAAAGAATTTAAGTCTAGAGTTGACT GCTGTTTGTAACGATTTAGGACCTTTGGTTTTCCCTGATTACGATAAATTAGCGACTGAG ATATTCTCTAAGAGAGACGGTTATGATGTCTCTTCTGATGCAGAGTCTTCTATAAGTCGT ATGAGTGTACAATCTAGAAGCCGCTCTTCTTCTATACATTCTATTGGCTCGCTAGCTTCT AACGCCCTATCAAGAGTGAATTCAAGAGGCTCGTTGACCGATATTCCAATTTTTTCTGAT GCAAAGCAAGGTCAATGGAAAAGTGAAGGTGAAACTAGTGAGGATGAGGATGAATTTGAT GAGAAAAATCCTGCCATAGTACAAACCGCACGAAGTTCTGATCTAAATAAGGAAAACAGT CGCAACACAAATATATCTTCGAAGATTGCTTCGCTGGTAAGACAGAAAAGAGAACACGAA AAGAAAGAATGA
Protein Properties
Pfam Domain Function
Protein Residues743
Protein Molecular Weight83644.0
Protein Theoretical pI10.0
Signalling Regions
  • None
Transmembrane Regions
  • 31-55
  • 69-85
  • 502-524
  • 539-555
Protein Sequence>Glycerol-3-phosphate O-acyltransferase 2 MSAPAADHNAAKPIPHVPQASRRYKNSYNGFVYNIHTWLYDVSVFLFNILFTIFFREIKV RGAYNVPEVGVPTILVCAPHANQFIDPALVMSQTRLLKTSAGKSRSRMPCFVTAESSFKK RFISFFGHAMGGIPVPRIQDNLKPVDENLEIYAPDLKNHPEIIKGRSKNPQTTPVNFTKR FSAKSLLGLPDYLSNAQIKEIPDDETIILSSPFRTSKSKVVELLTNGTNFKYAEKIDNTE TFQSVFDHLHTKGCVGIFPEGGSHDRPSLLPIKAGVAIMALGAVAADPTMKVAVVPCGLH YFHRNKFRSRAVLEYGEPIVVDGKYGEMYKDSPRETVSKLLKKITNSLFSVTENAPDYDT LMVIQAARRLYQPVKVRLPLPAIVEINRRLLFGYSKFKDDPRIIHLKKLVYDYNRKLDSV GLKDHQVMQLKTTKLEALRCFVTLIVRLIKFSVFAILSLPGSILFTPIFIICRVYSEKKA KEGLKKSLVKIKGTDLLATWKLIVALILAPILYVTYSILLIILARKQHYCRIWVPSNNAF IQFVYFYALLVFTTYSSLKTGEIGVDLFKSLRPLFVSIVYPGKKIEEIQTTRKNLSLELT AVCNDLGPLVFPDYDKLATEIFSKRDGYDVSSDAESSISRMSVQSRSRSSSIHSIGSLAS NALSRVNSRGSLTDIPIFSDAKQGQWKSEGETSEDEDEFDEKNPAIVQTARSSDLNKENS RNTNISSKIASLVRQKREHEKKE
References
External Links
ResourceLink
Saccharomyces Genome Database GPT2
Uniprot IDP36148
Uniprot NameGPT2_YEAST
GenBank Gene IDAJ311354
Genebank Protein ID16944703
General Reference
  • Zheng, Z., Zou, J. (2001). "The initial step of the glycerolipid pathway: identification of glycerol 3-phosphate/dihydroxyacetone phosphate dual substrate acyltransferases in Saccharomyces cerevisiae." J Biol Chem 276:41710-41716.11544256
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956