You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycogenin-1
Synonyms
  • Glycogen synthesis initiator protein 1
  • Glycogenin glucosyltransferase 1
Gene NameGLG1
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring glycosyl groups
Specific FunctionSelf-glucosylating initiator of glycogen synthesis. Catalyzes the formation of a short alpha (1,4)-glucosyl chain covalently attached via a glucose 1-O-tyrosyl linkage to internal tyrosine residues. These chains act as primers for the elongation reaction catalyzed by glycogen synthase. Capable of transferring glucosyl residues to unbound acceptors such as free oligoglucans or oligoglucan derivatives
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00212Uridine diphosphate glucoseShow
YMDB00307Uridine 5'-diphosphateShow
GO Classification
Component
Not Available
Function
transferase activity, transferring glycosyl groups
catalytic activity
transferase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 11
LocusYKR058W
Gene Sequence>1857 bp ATGGGAATGTATAAGAAGCTGGCTATTGCCACATTGCTCTATTCCGCAGATTATTTACCA GGTGTGTTTGCCCTTGGTCACCAAGTGAATAAATTGTTAGAGGAAGCAGGCAAAAAAGGC GACATTGAAACATGCCTTATTGTGACGACCTCTCTATTTAATGGCACTTTAAGCGAGCTA GCCAAGAATATTTTACAATCAATATACACCAAAATTGTGTTGGTAGAGCCTTTAAATTGC CAAGAAGAAAGCATACAGAAGAATAGTGAGAATTTAGCTCTTTTGGAAAGACCTGAATTA TCCTTTGCCTTAATCAAAGCAAGACTATGGGAATTAACTCAGTTCGAACAAGTTCTTTAC TTGGATTCCGACACTTTACCTCTGAATAAAGAATTTTTAAAGTTGTTTGACATTATGTCT AAACAAACCACGTCACAAGTGGGTGCTATTGCTGATATCGGCTGGCCTGATATGTTCAAT AGCGGTGTCATGATGCTAATACCGGATGCTGATACTGCATCCGTTTTACAAAATTATATT TTTGAAAACACTTCAATTGATGGTTCTGACCAGGGCATTTTAAACCAGTTCTTCAATCAA AATTGTTGCACTGATGAGCTAGTTAAAGACAGTTTCTCTCGAGAATGGGTACAGTTATCA TTTACGTATAACGTAACTATTCCTAATTTAGGCTACCAATCTTCACCTGCTATGAATTAC TTTAAACCTAGCATTAAGTTGATTCATTTCATTGGGAAACACAAGCCATGGTCATTGTGG TCCCAAAAGAATTTCATTAAAAACGAGTATCATGATCAATGGAATGAGGTATACGAGGAA TTTAAGGAAGAACATCAATTAAATAACGAAGTTTCGAAGCCAAAGATTAGTGATTCCGAT AAAACTGAGACTCCTGAAACGATAACCCCAGTGGATGCCCCTCCATCGAACGAACCCACT ACGAATCAAGAGATCGACACAATTAGTACAGTGGAAGAAAACGTGGACAACCAGAACGCC GAGCCTGTTCCTAACTCGGATCATAGCCCTGCTCCTAACCCTGTCCCATTGGATTTTACC AAGTGGTTAACAACCTTTATTAACAAAGATCACTTGACTAATCAGCCAGTAAATGAAAGC AGAGAATATTCGAAAGAGAATGATAACAATATAATCAATAGCAGTTCAAACCGCGACCAA GAAAGTCCTCCAAATAGTACTCAGGAACTAAACAGCTCTTATAGCGTTGTGAGTACTCAA GCTGATAGCGATGAGCACCAAAATGCAGAAGAGGAGGATAGTACGACAGATAACGCTTCA AATTCTGGAGAAGAAAGCCACCTCGATGATATAAGCACGGCCGCTTCTTCCAATAACAAT GTAAGTAATCAACCAGATGGCAAAAATTTTAGCAATTCTAAAGAAAATAATATCAGTGTC GAATCTAGCCCTTCAAATCCAGAACAGAAAAGGTCAACTGACAATATACAAAAACCAAGT GTTTCTACTAATGACTTACCAGACGACGTAGAACCACATACCTCTGTTGATGACAATATA CAGTACTTAGAAAAAGACAAGGAAGGTTATGAAGAATTTCTTCCGGACGTGTACGAGTCA AATGCAATCGATAACGAAGAAGAATTTTTTGATGACGATGCAAGAGATGCTACCGAAGGA GAAACGAAGACGAGTGCAGTTGCAGATAAACAGGAGGATATGAAACTTACAGCAGAGGAA ACCAACCAACCGCAACAAGAAATGCCCAACTTCAAATTTGACTGGGAGGACTCTGATTAT CTATCCAAAGTAGAGAGGTGTTTCCCTGATGATATTTTTGAGTATGCAGTAGAGTAA
Protein Properties
Pfam Domain Function
Protein Residues616
Protein Molecular Weight69723.39844
Protein Theoretical pI3.98
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycogenin-1 MYKKLAIATLLYSADYLPGVFALGHQVNKLLEEAGKKGDIETCLIVTTSLFNGTLSELAK NILQSIYTKIVLVEPLNCQEESIQKNSENLALLERPELSFALIKARLWELTQFEQVLYLD SDTLPLNKEFLKLFDIMSKQTTSQVGAIADIGWPDMFNSGVMMLIPDADTASVLQNYIFE NTSIDGSDQGILNQFFNQNCCTDELVKDSFSREWVQLSFTYNVTIPNLGYQSSPAMNYFK PSIKLIHFIGKHKPWSLWSQKNFIKNEYHDQWNEVYEEFKEEHQLNNEVSKPKISDSDKT ETPETITPVDAPPSNEPTTNQEIDTISTVEENVDNQNAEPVPNSDHSPAPNPVPLDFTKW LTTFINKDHLTNQPVNESREYSKENDNNIINSSSNRDQESPPNSTQELNSSYSVVSTQAD SDEHQNAEEEDSTTDNASNSGEESHLDDISTAASSNNNVSNQPDGKNFSNSKENNISVES SPSNPEQKRSTDNIQKPSVSTNDLPDDVEPHTSVDDNIQYLEKDKEGYEEFLPDVYESNA IDNEEEFFDDDARDATEGETKTSAVADKQEDMKLTAEETNQPQQEMPNFKFDWEDSDYLS KVERCFPDDIFEYAVE
References
External Links
ResourceLink
Saccharomyces Genome Database GLG1
Uniprot IDP36143
Uniprot NameGLG1_YEAST
GenBank Gene IDU25546
Genebank Protein ID902793
General Reference
  • Cheng, C., Mu, J., Farkas, I., Huang, D., Goebl, M. G., Roach, P. J. (1995). "Requirement of the self-glucosylating initiator proteins Glg1p and Glg2p for glycogen accumulation in Saccharomyces cerevisiae." Mol Cell Biol 15:6632-6640.8524228
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Mu, J., Cheng, C., Roach, P. J. (1996). "Initiation of glycogen synthesis in yeast. Requirement of multiple tyrosine residues for function of the self-glucosylating Glg proteins in vivo." J Biol Chem 271:26554-26560.8900126
  • Parrou, J. L., Enjalbert, B., Plourde, L., Bauche, A., Gonzalez, B., Francois, J. (1999). "Dynamic responses of reserve carbohydrate metabolism under carbon and nitrogen limitations in Saccharomyces cerevisiae." Yeast 15:191-203.10077186
  • Brachat, S., Dietrich, F. S., Voegeli, S., Zhang, Z., Stuart, L., Lerch, A., Gates, K., Gaffney, T., Philippsen, P. (2003). "Reinvestigation of the Saccharomyces cerevisiae genome annotation by comparison to the genome of a related fungus: Ashbya gossypii." Genome Biol 4:R45.12844361
  • Cliften, P., Sudarsanam, P., Desikan, A., Fulton, L., Fulton, B., Majors, J., Waterston, R., Cohen, B. A., Johnston, M. (2003). "Finding functional features in Saccharomyces genomes by phylogenetic footprinting." Science 301:71-76.12775844