You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSedoheptulose 1,7-bisphosphatase
SynonymsNot Available
Gene NameSHB17
Enzyme ClassNot Available
Biological Properties
General Functionribosome biogenesis
Specific FunctionSedoheptulose 1,7-bisphosphatase involved in riboneogenesis. Dephosphorylates sedoheptulose 1,7-bisphosphate (SBP), which is converted via the non-oxidative pentose phosphate pathway to ribose-5-phosphate. Has a fructose 1,6-bisphosphatase activity in vitro, but this is probably not biologically relevant, since deletion does not affect fructose 1,6-biphosphate (FBP) levels.
Cellular LocationNot Available
SMPDB Pathways
RiboneogenesisPW002511 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB Reactions
sedoheptulose 1,7-bisphosphate + waterD-Sedoheptulose 7-phosphate + phosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00196D-Sedoheptulose 7-phosphateShow
YMDB00753sedoheptulose 1,7-bisphosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Function
cytosol
nucleus
ribosome biogenesis
sedoheptulose-bisphosphatase activity
carbohydrate metabolic process
ribose phosphate biosynthetic process
oxidoreductase activity
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>816 bp ATGCCTTCGCTAACCCCCAGATGTATCATTGTCAGACACGGTCAAACTGAATGGTCCAAG TCAGGCCAGTATACTGGTTTGACAGATCTACCGTTAACGCCCTACGGTGAGGGCCAAATG TTGAGGACCGGTGAGAGTGTTTTCCGCAATAATCAGTTTTTGAATCCAGACAACATCACT TATATCTTCACCTCTCCACGTTTGCGTGCCAGGCAAACTGTGGATTTGGTTTTGAAACCA TTAAGCGACGAGCAAAGAGCTAAGATCCGTGTGGTGGTAGACGACGACTTGCGAGAGTGG GAGTACGGTGACTACGAGGGAATGCTGACTCGAGAAATCATTGAATTGAGAAAGTCACGC GGTTTGGACAAGGAGAGGCCATGGAATATCTGGAGAGATGGGTGTGAGAACGGTGAGACT ACTCAGCAAATTGGGTTGAGACTTTCCCGCGCTATTGCCAGAATCCAGAACTTGCACCGC AAGCACCAGAGTGAGGGCAGAGCATCAGACATCATGGTCTTTGCGCACGGACATGCATTG CGTTATTTTGCTGCTATTTGGTTTGGACTGGGTGTGCAAAAGAAGTGTGAGACGATTGAA GAAATTCAAAATGTCAAATCTTATGATGACGACACAGTTCCATATGTGAAATTGGAATCT TACAGACATTTGGTAGACAATCCATGTTTCTTACTGGACGCCGGTGGGATTGGTGTTTTG TCATACGCTCACCACAACATTGACGAACCTGCATTGGAATTAGCAGGTCCATTTGTCTCA CCACCAGAGGAGGAATCCCAGCATGGCGATGTGTAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues271
Protein Molecular Weight31021.71
Protein Theoretical pINot Available
PDB Fileshow
Signalling RegionsNot Available
Transmembrane RegionsNot Available
Protein Sequence>Sedoheptulose 1,7-bisphosphatase MPSLTPRCIIVRHGQTEWSKSGQYTGLTDLPLTPYGEGQMLRTGESVFRNNQFLNPDNIT YIFTSPRLRARQTVDLVLKPLSDEQRAKIRVVVDDDLREWEYGDYEGMLTREIIELRKSR GLDKERPWNIWRDGCENGETTQQIGLRLSRAIARIQNLHRKHQSEGRASDIMVFAHGHAL RYFAAIWFGLGVQKKCETIEEIQNVKSYDDDTVPYVKLESYRHLVDNPCFLLDAGGIGVL SYAHHNIDEPALELAGPFVSPPEEESQHGDV
References
External Links
ResourceLink
Saccharomyces Genome Database SHB17
Uniprot IDP36136
Uniprot NameSHB17
PDB ID
3F3K
General ReferenceNot Available