You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhospholipase D1
Synonyms
  • PLD 1
  • Choline phosphatase 1
  • Meiosis-specific sporulation-specific protein 14
  • Phosphatidylcholine-hydrolyzing phospholipase D1
Gene NameSPO14
Enzyme Class
Biological Properties
General FunctionInvolved in protein binding
Specific FunctionRequired for meiosis and spore formation. Seems to be involved in the coordinate induction of late meiotic events. PLD activity is induced under sporulation conditions and seems to be necessary to complete the meiotic cycle, but not for vegetative cell growth
Cellular LocationNot Available
SMPDB Pathways
Choline metabolismPW002494 ThumbThumb?image type=greyscaleThumb?image type=simple
Ether lipid metabolismPW002492 ThumbThumb?image type=greyscaleThumb?image type=simple
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Ether lipid metabolismec00565 Map00565
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
PC(16:0/16:0) + waterCholine + hydron + PA(16:0/16:0)
KEGG Reactions
phosphatidylcholine + waterLPA(16:0/0:0) + Choline
Metabolites
YMDB IDNameView
YMDB00227CholineShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB01161PA(16:0/16:0)Show
YMDB01180PC(16:0/16:0)Show
GO Classification
Component
Not Available
Function
binding
protein binding
lipid binding
phospholipid binding
phosphoinositide binding
catalytic activity
Process
metabolic process
cellular process
cell communication
Gene Properties
Chromosome Locationchromosome 11
LocusYKR031C
Gene Sequence>5052 bp ATGTCTAACGTGTCAACAGCGTCTGGAACTCACTTCGCTCCACCTCAGGCAGATAGATCG GTGACTGAAGAAGTAGATAGAGTAAATTCGAGACCAGATGAGTTAGAAAACCAAGAAGTA TTGCGGCAATTACCTGAGAATGGCAATCTGACTAGCAGTTTACAAAGAGAAAAACGAAGA ACTCCCAACGGCAAGGAGGCGGAGAGGAAGCATGCATTGCCCAAATCCTTTGTAGATAGA AACCTGAGTGATGTGTCACCGAACCACTCATTAGACCATATTATGCACTCTAATGAACAT GATCCTCGTCGAGGTTCTGATGAGGAAAATATGCACCGGCTCTACAACAATCTCCATAGC AGTAACAATAATGTTCATTCTAAGCGGAATTCTAAAAGAGAGGAAGAAAGAGCCCCTCAA AGGCGTTCTTCTTCTGTAGCTTACACCCAACAGCAGTTCAATGGCTGGAAGAAAGAGTTT GGCCACGCTTTTAAGAAAATCTCTGCTATTGGTAGACTGAAATCCAGCGTAAATTCTCCT ACACCGGCTGGAAGCGGCCATCGTCATAACCAGCACCAGCATCAACAAGTAAACGAAGAA GATTTGTACACACAAAGACTAGCCTCTGATTTATTAGATTCGTTATTGGCAGGATGCCCG GCCTCATTGTTCGCAAGCACGCAATTTCTGAGAGACGAACATGGGAAGAGAAGGGCTCCT CTGCTATTAGCTAAACTAGATGTAAGAGTGTCTCCCTTGAAAAATGACAACAACATTTTG GATATTACCAATAGCAACCATAACCATCGTGGTAACAACAACAACAATACTGGCGAGAAT TCTGATAGGAGACCCTCTATTCCAAGGAGCTCCAGCATTATAAGCATTTCTTCGAATGTG GCGGAATTTATGTATAGCAGGAACGAAAACTCTTTATTTAGAATACACTTGGAATATGGG ATTGATGAAGACAGGCTCAAATGGTCTATTATAAGAAGTTATAAAGATATCAAATCACTA CATCACAAATTGAAAATCGTCGCGTTCCAACAACTCACTATAAGCAAGCTTTATAGTGAT AACAACAGATATCATTCGTTACAACTTCCGCATTTCCCCCATTATAAAGAAATGGTTAAA GAAAGAAATGTAATGGAGAAAAAAGCAGAAAATAAACCATCCTCTGCAGCCTCAGCTCCT CATACATCGGAAAATAACAATAACGATAATGGCAGCAACATTACATCGTTAGAAACTTTA TCATCTTCTGAAATATCTGAGTTTAATATAGATAACGTCAAAATGAAACATTTACAAGAC TTAATTGACGAACCTGACGATTTCTCCCAACCGATACATTTGAGGCTAGAAAGGTATTTG AGACTACTGAACATTGCATTATGTTTGAGACCTCATGCAAATAGATTGTTTGAATTTTAC GAATTATCTCCCTTAGGCAATTTATTAAGTCGTGAAAGTGGGTTCCAGGGCAAACAGGGG TATTTAGTAATTAGATCTACTGCCAAGGCCCAAGGTTGGAGAGTTTCTCATTTTGGTAAA CATGCGTTTAAAGACATGATCGACAGACATACTACCAAATGGTTCCTGGTAAGAAATTCT TACCTAACTTACGTGTCGGATCTTTCTTCGACAACTCCTTTAGACGTATTCTTAATAGAT TGGAAATTTAAGGTTAGATTTTCTGGGAACAAGAATAACATACTTGATAACGAAAACGAG ATCAACTGGATCATTCATGATCCCAATTTAGAAATAAATGACGAACTAGAAGAGTTCGGT ATTGAAAATGATGCCAATAATATCCTAGACAAGAATGGAAAATCGAAAACACACCAAAAG AAGTCCAATATATCTTCAAAACTATTATTATTGACCCTAGAAAACAGTGAAAGGAAACTG AAAATTATTTGCAAATCAGAGAGTTCGTTAAAGCAATGGATGAGTTCAATTATCAAAATG TCTACCTCAACACCTTGGTCGAAACCAAATAGATTTGGTAGTTTCGCACCTGTAAGAACA AATTCGTTTTGCAAATTTTTGGTAGATGGGCGTGATTATTTTTGGTCGTTAAGCGAGGCC CTCTTAATGGCAAAGGATGTCATATATATCCATGATTGGTGGCTATCCCCTGAATTATAC TTGCGACGTCCGGTGAAAGGCAACCAGGGATTTAGAATTGATCGTATGCTGAAAAGTTGT GCAGAAAAAGGTATCAAAATTTTTATTGTGATTTATAGGAATGTGGGGAATATTGTTGGG ACAGATAGTCTTTGGACCAAGCATTCTATGCTAAATTTACATCCAAATATACATATCATA AGGTCTCCCAATCAATGGCTACAAAATACATATTTTTGGGCACACCACGAGAAGTTTGTC GTTATTGATGAAACATTTGCATTTATTGGTGGTACAGATTTATGTTATGGTAGATATGAT ACTTTTGAACACGTTCTACGAGATGATGCAGAATCTTTATTAGATCAAAATTTTCCTGGT AAGGATTATTCAAATGCCAGAATTGCTGATTTTCATGATTTAGATAAACCATTCGAATCA ATGTATGATAGAAAAGTCATTCCGAGGATGCCATGGCATGATGTGCAAATGATGACTTTG GGTGAGCCAGCAAGAGACTTAGCCCGACATTTTGTTCAAAGATGGAATTACTTATTGAGA GCTAAGAGACCTAGTAGGTTAACTCCATTACTAACCCCGCCTTCAGATTTAACTGCTGAA GAATTGAAGAGTTTGCCGATGTTCGAAATTCTACGCGAAAAATCGACTTGTGAAACTCAA ATACTTAGAAGTGCTGGGAACTGGTCTCTTGGGCTAAAGGAAACGGAATGCTCAATTCAA AATGCTTACCTGAAGTTAATTGAACAAAGTGAACACTTTATTTATATTGAGAATCAATTC TTCATTACATCAACTGTCTGGAACGGGACTTGCGTTTTGAATAAAATTGGTGATGCTCTC GTTGATAGGATAGTCAAAGCTAATCAGGAGAAAAAACCTTGGAAAGCCTTTATTCTTATC CCACTAATGCCAGGATTCGATTCTCCAGTAGATACTGCAGAAGCCTCAAGTCTTCGTTTA ATTATGCAATTCCAATATCAATCAATTTCAAGAGGTGAACATTCTACATTTAGTAAACTG AAGAAACTAAATATTGACCCAGCTCAATATATTCAGTTCTTTTCACTAAGAAAATGGTCG ACTTTTGCGCCTAATGAAAGATTAATCACCGAGCAGCTCTACGTTCATGCTAAAATTCTG ATTGCTGATGACAGAAGATGTATTATAGGGTCTGCTAATATTAACGAAAGATCACAACTG GGTAATAGAGATAGTGAGGTGGCAATTCTTATTAGAGACACCGACTTGATAAAGACCAAA ATGAATGGTGACGATTACTACGCGGGAAAATTTCCTTGGGAATTAAGGCAGCGATTAATG AGGGAACATTTAGGTTGTGATGTAGATCTTGTTGAGTTTGTTGAAAAGAAATTTGAAAGG TTTGAAAAGTTTGCTGCAAAGAATTATGAAAAACTTCATACCCTAAGTAAGGAGGGAGAT AGTGGTAACAATTGGAGCGATCGAGAAATGATCGATTCCGCTATGATTGAGCTAGGTTAT CGTGAAATATTTGGTTGTAAATTTAGCCCTCAATGGAAGAGTGGTCATGGAAACAGTGTT GATGATGGAAGCACTCAGTGTGGCATAAATGAAAAAGAAGTGGGAAGAGAAGATGAAAAC GTTTATGAAAAATTCTTCAATTCTGTGGACTACGGTAAATCATCACGTAAGAGAACGCCT CTGCCCAAACATAATTTTGCATCTTTAGGGCTAACATTCAACCACAGGGCAGGAATTGAA AATGTCGGTATACGAGACCACAAAGTCTTAAGTACTGATCCAAGATTAAGAAAGAATGAT GAACATAAAAAAGAGGTTGATGGCTACGGTCCCGATTGTTGGAAAAAGGAATCCAACAAA AAATTCAAGGCCGATGCAACTGAACAGCTAAAGGAGTGGGCATTGAACTCATTGGCCTCG AAAGTTCTTGACGATAAAGAAATGATAAAATCAGAAATTCCAGAAGGATTTTCAAATTAT TTGCCCAATGAGAAAGATCTAGAAATGTATCTCACGGATAAAACTGTTACCAATAGAAAC AAATGGAGTATGCTCAAAAGGATATGCTACTTGCAATATTTATCTCATAAACTCGACGAA AGAAAAACACAGAGATTGAAGAAAATCAAAGATATGAGAAGACATTTAAGTTCAAGCACA GAAAGTACCAGAAATGGGTCTAATAGTCTGCCATTAAACGAAAAGAGCAATGAAGGAGAA AGCACTAATGTCGACCAAGATATCGAAGGCGATGAATATCATAGATTGCACGAAGATATT TTGAAAAATCAAGAACTAGATGATGGTTCACTGGACGATCTACTTTCTCAGATAATTCCT AAGATCACTAACTTTAACAGTGGTGAAATTGATGACGCAAAAAAAGAAGAGTTATTGAAA CTCAACTTCATTGACCCGTATTCCTTCGAGGATCCTCTTATTTCTTCGTTTTCTGAAGGG CTATGGTTCACTATAGCCTTGAGAAATACATTACTCTATAAATTAGTGTTTCATTGTCAA CCCGATAATGCTGTACAAAATTGGAAAGAATATGGAGAATTTACTGAATTAGAACAAGAA TTTCAAATAAACCAGGAAAAGTTGATTGACTTAGAGGCTGAAAATATTAATTCTACTACT ACAAATGTTGTAGATAAGGATAGGGAAAAGGAAAAAATGAGAAAAGCCGCTGAATTGAGA ATGAAGTTATCCGGTAGTTTGCTTTATGGATTCAATCAAAAGGTTTTTGACAAACATACG GCGCAGAGAATCTTGGAAAGGATCCACGGTCATTTGGTCATTTTCCCAACCGAATGGTTA GCTAAAGAAGTTGAGAGTAGAAATTGGATTTTTAACTCGGATAGACTTTCTCCAATGGAA ATCTACAATTAA
Protein Properties
Pfam Domain Function
Protein Residues1683
Protein Molecular Weight195202.0
Protein Theoretical pI7.63
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phospholipase D1 MSNVSTASGTHFAPPQADRSVTEEVDRVNSRPDELENQEVLRQLPENGNLTSSLQREKRR TPNGKEAERKHALPKSFVDRNLSDVSPNHSLDHIMHSNEHDPRRGSDEENMHRLYNNLHS SNNNVHSKRNSKREEERAPQRRSSSVAYTQQQFNGWKKEFGHAFKKISAIGRLKSSVNSP TPAGSGHRHNQHQHQQVNEEDLYTQRLASDLLDSLLAGCPASLFASTQFLRDEHGKRRAP LLLAKLDVRVSPLKNDNNILDITNSNHNHRGNNNNNTGENSDRRPSIPRSSSIISISSNV AEFMYSRNENSLFRIHLEYGIDEDRLKWSIIRSYKDIKSLHHKLKIVAFQQLTISKLYSD NNRYHSLQLPHFPHYKEMVKERNVMEKKAENKPSSAASAPHTSENNNNDNGSNITSLETL SSSEISEFNIDNVKMKHLQDLIDEPDDFSQPIHLRLERYLRLLNIALCLRPHANRLFEFY ELSPLGNLLSRESGFQGKQGYLVIRSTAKAQGWRVSHFGKHAFKDMIDRHTTKWFLVRNS YLTYVSDLSSTTPLDVFLIDWKFKVRFSGNKNNILDNENEINWIIHDPNLEINDELEEFG IENDANNILDKNGKSKTHQKKSNISSKLLLLTLENSERKLKIICKSESSLKQWMSSIIKM STSTPWSKPNRFGSFAPVRTNSFCKFLVDGRDYFWSLSEALLMAKDVIYIHDWWLSPELY LRRPVKGNQGFRIDRMLKSCAEKGIKIFIVIYRNVGNIVGTDSLWTKHSMLNLHPNIHII RSPNQWLQNTYFWAHHEKFVVIDETFAFIGGTDLCYGRYDTFEHVLRDDAESLLDQNFPG KDYSNARIADFHDLDKPFESMYDRKVIPRMPWHDVQMMTLGEPARDLARHFVQRWNYLLR AKRPSRLTPLLTPPSDLTAEELKSLPMFEILREKSTCETQILRSAGNWSLGLKETECSIQ NAYLKLIEQSEHFIYIENQFFITSTVWNGTCVLNKIGDALVDRIVKANQEKKPWKAFILI PLMPGFDSPVDTAEASSLRLIMQFQYQSISRGEHSTFSKLKKLNIDPAQYIQFFSLRKWS TFAPNERLITEQLYVHAKILIADDRRCIIGSANINERSQLGNRDSEVAILIRDTDLIKTK MNGDDYYAGKFPWELRQRLMREHLGCDVDLVEFVEKKFERFEKFAAKNYEKLHTLSKEGD SGNNWSDREMIDSAMIELGYREIFGCKFSPQWKSGHGNSVDDGSTQCGINEKEVGREDEN VYEKFFNSVDYGKSSRKRTPLPKHNFASLGLTFNHRAGIENVGIRDHKVLSTDPRLRKND EHKKEVDGYGPDCWKKESNKKFKADATEQLKEWALNSLASKVLDDKEMIKSEIPEGFSNY LPNEKDLEMYLTDKTVTNRNKWSMLKRICYLQYLSHKLDERKTQRLKKIKDMRRHLSSST ESTRNGSNSLPLNEKSNEGESTNVDQDIEGDEYHRLHEDILKNQELDDGSLDDLLSQIIP KITNFNSGEIDDAKKEELLKLNFIDPYSFEDPLISSFSEGLWFTIALRNTLLYKLVFHCQ PDNAVQNWKEYGEFTELEQEFQINQEKLIDLEAENINSTTTNVVDKDREKEKMRKAAELR MKLSGSLLYGFNQKVFDKHTAQRILERIHGHLVIFPTEWLAKEVESRNWIFNSDRLSPME IYN
References
External Links
ResourceLink
Saccharomyces Genome Database SPO14
Uniprot IDP36126
Uniprot NameSPO14_YEAST
GenBank Gene IDZ28256
Genebank Protein ID486463
General Reference
  • Honigberg, S. M., Conicella, C., Espositio, R. E. (1992). "Commitment to meiosis in Saccharomyces cerevisiae: involvement of the SPO14 gene." Genetics 130:703-716.1582554
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Rose, K., Rudge, S. A., Frohman, M. A., Morris, A. J., Engebrecht, J. (1995). "Phospholipase D signaling is essential for meiosis." Proc Natl Acad Sci U S A 92:12151-12155.8618862
  • Waksman, M., Eli, Y., Liscovitch, M., Gerst, J. E. (1996). "Identification and characterization of a gene encoding phospholipase D activity in yeast." J Biol Chem 271:2361-2364.8576189
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956