Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFree methionine-R-sulfoxide reductase
Synonyms
  • fRMsr
  • GAF domain-containing protein YKL069W
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in protein binding
Specific FunctionCatalyzes the reversible oxidation-reduction of the R- enantiomer of free methionine sulfoxide to methionine. Does not act on S-enantiomer of free methionine sulfoxide or R-enantiomer of dabsylated methionine sulfoxide. Involved in protection against oxidative stress
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00035L-methionine (R)-S-oxideShow
YMDB00318L-MethionineShow
GO ClassificationNot Available
Gene Properties
Chromosome LocationNot Available
LocusYKL069W
Gene Sequence>543 bp ATGGGCTCATCAACCGGGTTTCATCATGCCGATCATGTTAACTATTCTTCAAATCTGAAT AAGGAAGAAATTCTAGAACAGCTTCTGCTTTCATACGAGGGGCTATCAGATGGACAAGTC AATTGGGTTTGTAATTTGTCAAACGCTTCGTCATTGATCTGGCATGCGTACAAGTCATTA GCTGTTGATATCAATTGGGCTGGATTTTACGTTACTCAAGCTAGCGAAGAAAACACACTG ATATTGGGCCCATTTCAAGGAAAGGTCGCTTGCCAAATGATTCAATTCGGTAAAGGTGTT TGCGGAACTGCAGCCTCTACAAAGGAAACGCAGATTGTTCCAGATGTCAACAAGTATCCC GGTCATATTGCGTGCGACGGTGAAACCAAGAGCGAAATTGTTGTTCCAATCATATCCAAT GATGGTAAGACATTGGGCGTCATAGACATAGATTGTTTGGATTACGAAGGATTCGACCAC GTAGACAAAGAATTCCTAGAAAAACTTGCTAAATTAATTAATAAATCATGTGTCTTTAAA TAA
Protein Properties
Pfam Domain Function
Protein Residues180
Protein Molecular Weight19734.19922
Protein Theoretical pI4.69
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Free methionine-R-sulfoxide reductase MGSSTGFHHADHVNYSSNLNKEEILEQLLLSYEGLSDGQVNWVCNLSNASSLIWHAYKSL AVDINWAGFYVTQASEENTLILGPFQGKVACQMIQFGKGVCGTAASTKETQIVPDVNKYP GHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHVDKEFLEKLAKLINKSCVFK
References
External Links
ResourceLink
Saccharomyces Genome Database YKL069W
Uniprot IDP36088
Uniprot NameFRMSR_YEAST
GenBank Gene IDX75780
Genebank Protein ID433630
PDB ID
1F5M
General Reference
  • Rasmussen, S. W. (1994). "Sequence of a 20.7 kb region of yeast chromosome XI includes the NUP100 gene, an open reading frame (ORF) possibly representing a nucleoside diphosphate kinase gene, tRNAs for His, Val and Trp in addition to seven ORFs with weak or no significant similarity to known proteins." Yeast 10 Suppl A:S69-S74.8091863
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Le, D. T., Lee, B. C., Marino, S. M., Zhang, Y., Fomenko, D. E., Kaya, A., Hacioglu, E., Kwak, G. H., Koc, A., Kim, H. Y., Gladyshev, V. N. (2009). "Functional analysis of free methionine-R-sulfoxide reductase from Saccharomyces cerevisiae." J Biol Chem 284:4354-4364.19049972
  • Ho, Y. S., Burden, L. M., Hurley, J. H. (2000). "Structure of the GAF domain, a ubiquitous signaling motif and a new class of cyclic GMP receptor." EMBO J 19:5288-5299.11032796