You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSulfiredoxin
Synonyms
  • Sulphiredoxin
Gene NameSRX1
Enzyme Class
Biological Properties
General FunctionInvolved in DNA binding
Specific FunctionContributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in the peroxiredoxin TSA1. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and as thioltransferase
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
DNA binding
sulfiredoxin activity
catalytic activity
binding
oxidoreductase activity
nucleic acid binding
oxidoreductase activity, acting on a sulfur group of donors
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 11
LocusYKL086W
Gene Sequence>384 bp ATGTCACTACAAAGCAACAGTGTAAAACCAACAGAAATTCCTCTCTCAGAGATCAGACGC CCCCTAGCGCCTGTGTTGGATCCTCAAAAGATCGACGCAATGGTGGCCACAATGAAGGGC ATTCCCACCGCTAGCAAGACATGCTCTCTAGAACAGGCTGAGGCGGCTGCCTCAGCCGGG GAACTGCCGCCCGTGGACGTGCTGGGCGTGCGAGTCAAGGGACAGACGCTATATTATGCC TTCGGCGGCTGCCACCGTCTACAGGCATACGACCGCCGGGCTCGCGAAACGCAGAACGCC GCCTTCCCCGTGCGCTGCAGGGTGCTACCGGCCACTCCCCGCCAAATCCGCATGTACCTG GGCAGCAGTCTCGACATCGAATAA
Protein Properties
Pfam Domain Function
Protein Residues127
Protein Molecular Weight13853.90039
Protein Theoretical pI9.25
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Sulfiredoxin MSLQSNSVKPTEIPLSEIRRPLAPVLDPQKIDAMVATMKGIPTASKTCSLEQAEAAASAG ELPPVDVLGVRVKGQTLYYAFGGCHRLQAYDRRARETQNAAFPVRCRVLPATPRQIRMYL GSSLDIE
References
External Links
ResourceLink
Saccharomyces Genome Database SRX1
Uniprot IDP36077
Uniprot NameSRX1_YEAST
GenBank Gene IDAY558350
Genebank Protein ID45270590
General Reference
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Biteau, B., Labarre, J., Toledano, M. B. (2003). "ATP-dependent reduction of cysteine-sulphinic acid by S. cerevisiae sulphiredoxin." Nature 425:980-984.14586471