You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePolyamine transporter TPO5
SynonymsNot Available
Gene NameTPO5
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionRequired for polyamine transport. Transports putrescine effectively and spermidine less effectively
Cellular LocationGolgi apparatus membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00132PutrescineShow
YMDB00232SpermidineShow
GO Classification
Component
intrinsic to membrane
integral to membrane
cell part
membrane
membrane part
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 11
LocusYKL174C
Gene Sequence>1857 bp ATGCCAGAGTATACGCTACTGGCTGATAATATAAGGGAGAATATCGTTCATTTCGATCCG AATGGTTTGTTTGATAACTTGCACACCATTGTTCATGAAGATGACAGTCAAGAGAACGAG GAGGCCGAGCATTTCAATTATGATCAGGTGTTGGATAAATCGTTATTGTCAAGAGGTTCT ATTGTCGGTCTCGGTTTAGGACTAATGAGTCCCGTTTTAGGAATGTGCACTAGTATGGCC ATTGGGCTAATTAATGGTGGTCCGTTAACTATAATGCTAGGTTTTTTAATCAGTGGAGTG TGTATATGGTTTTCGTCGCTTTCTCTTGGTGAGATTGTTTCAAAATTTCCGATGGAACTG CATGTTGGGAGTGCCATGTTGGCCCCGGAGAAATTGAAATTAGTATGTTCGTGGTACACT GGCTGGTTAATGCTCATAGGGAATTGGACTATGAGTACCAGTATTACTTTTGCAGGCGCT CAACTTACCATTTCTTTGATTCTGATGACGAACTCCAACCTAATATCCGAGGCACACTTG ATTTTTTACACAGTCATTGTATTTTACTTAGTTGTGACTGTTGTAGGCCTCGTGAATTTG AAATTTGCAAGATTTATTGAAACAATAAACAAAGTCTGTGTTTATTGGATCATATATGCC ATTATATTTATTGATATTCTTCTACTAGTATTCCACAAAGGTAAATTTCGATCTTTGAAG TACGCGCTATTTCACTTTGATAATAATCTATCAGGGTATAAAAGCGCATTTCTTTCCTTC ATCATTGGATTCCAACAGTCTAATTTCACGTTACAAGGTTTCAGTATGTTACCTGCTTTA GCTGACGAAGTCAAAGTTCCTGAGAAGGATATTCCACGTGGTATGTCGAATGCGGTATTG TTATCCGCGTTCTCTGGAGTCATTTTTCTTATACCAATAATGTTAATCCTGCCAGATAAT GATTTGCTTTTTACCAATCATAAGGTTCTACCAATAGTGAACATTTTTACAAAATCGACT GATTCGGTGGTCTTGTCTTTTTTTTTAGTGCTCCTAATTTTAGGAAACTTACTGTTTTCC GGAATTGGCTCGATTACTACATCTTCTCGTGCGGTATATAGTTTTAGTCGTGACCAGGCT ATACCATACTACGATAAATGGACCTACGTCGAACCGGATTCTCAGTCAAAAGTCCCCAAG AATTCTGTTGTATTGAGTATGATAATATCATACTTTTTAGGTCTGCTAGCTTTGATTTCA ACGGCCGCATTTAATGCTTTTATAGGCGCTGCAGTGCTCTGTCTTTGTTCTGCGACTTTC ATTCCGTTAGTCTTGGTGCTGTTTACGAGAAGAAGAGCTATCCGAAGCGCGCCAGTAAAA ATCAGGTATAAGTTTGGTTGGTTCATCAACATTGTTTCTATTGTGTGGCTCTTGTTATCT ATGGTTTCTGTTTGCCTACCAACGCAAGTGCCTGTAACTTTCAAAACAATGAATTATGCT TTAATGGTGTACGTATTCTGCATTTTAGTTATCACTGGTCTTTATTTCAAATGGGGGAAG TATAATTTTAGATTACCCTTGGCAGATGACATCAAGGCTCCAATTCCCAGTGATGCGGAA GAAACTGTTTTTGAACTAGAGGATAGCAATGTTGAACATACTCTAAACTCGGGAACCACA GTGAAAGAGTCTGTAGAAAATAATTCTGAAGAAGGTTTCATCAAGGTGCATCCTAAAAGT AGTACAGAAAATCCCTTTGAGGAAAATGAGGAAAACGTGATAACCGATTATGGTGATGAG CACCATACAGCAGAACAAGAATTTGATCTTGCCGATGATCGTAGATATGATATATGA
Protein Properties
Pfam Domain Function
Protein Residues618
Protein Molecular Weight69242.0
Protein Theoretical pI5.02
Signalling Regions
  • None
Transmembrane Regions
  • 61-84
  • 91-110
  • 132-148
  • 155-171
  • 180-200
  • 212-231
  • 298-317
  • 343-367
  • 403-419
  • 426-449
  • 465-486
  • 499-516
Protein Sequence>Polyamine transporter TPO5 MPEYTLLADNIRENIVHFDPNGLFDNLHTIVHEDDSQENEEAEHFNYDQVLDKSLLSRGS IVGLGLGLMSPVLGMCTSMAIGLINGGPLTIMLGFLISGVCIWFSSLSLGEIVSKFPMEL HVGSAMLAPEKLKLVCSWYTGWLMLIGNWTMSTSITFAGAQLTISLILMTNSNLISEAHL IFYTVIVFYLVVTVVGLVNLKFARFIETINKVCVYWIIYAIIFIDILLLVFHKGKFRSLK YALFHFDNNLSGYKSAFLSFIIGFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSNAVL LSAFSGVIFLIPIMLILPDNDLLFTNHKVLPIVNIFTKSTDSVVLSFFLVLLILGNLLFS GIGSITTSSRAVYSFSRDQAIPYYDKWTYVEPDSQSKVPKNSVVLSMIISYFLGLLALIS TAAFNAFIGAAVLCLCSATFIPLVLVLFTRRRAIRSAPVKIRYKFGWFINIVSIVWLLLS MVSVCLPTQVPVTFKTMNYALMVYVFCILVITGLYFKWGKYNFRLPLADDIKAPIPSDAE ETVFELEDSNVEHTLNSGTTVKESVENNSEEGFIKVHPKSSTENPFEENEENVITDYGDE HHTAEQEFDLADDRRYDI
References
External Links
ResourceLink
Saccharomyces Genome Database TPO5
Uniprot IDP36029
Uniprot NameTPO5_YEAST
GenBank Gene IDZ26878
Genebank Protein ID407507
General Reference
  • Vandenbol, M., Bolle, P. A., Dion, C., Portetelle, D., Hilger, F. (1994). "Sequencing and analysis of a 20.5 kb DNA segment located on the left arm of yeast chromosome XI." Yeast 10 Suppl A:S25-S33.8091858
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Tachihara, K., Uemura, T., Kashiwagi, K., Igarashi, K. (2005). "Excretion of putrescine and spermidine by the protein encoded by YKL174c (TPO5) in Saccharomyces cerevisiae." J Biol Chem 280:12637-12642.15668236
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956