Identification
Name: Probable folylpolyglutamate synthase
Synonyms
  • Folylpoly-gamma-glutamate synthetase
  • FPGS
  • Tetrahydrofolylpolyglutamate synthase
  • Tetrahydrofolate synthase
Gene Name: RMA1 Link_out
Enzyme Class:
Biological Properties
General Function: Involved in tetrahydrofolylpolyglutamate synthase activity
Specific Function: Conversion of folates to polyglutamate derivatives
Cellular Location: Mitochondrion
Pathways:
  • Folate biosynthesis 00790 Link_out
  • Reactions:
    • ATP + tetrahydropteroyl-(gamma-Glu)(n) + L-glutamate = ADP + phosphate + tetrahydropteroyl-(gamma-Glu)(n+1).
    Metabolites:
    YMDB ID Name View
    YMDB00109Adenosine triphosphate
    YMDB00271L-Glutamic acid
    YMDB00907phosphate
    YMDB00914ADP
    GO Classification:
    Component
    Not Available
    Function
    binding
    nucleoside binding
    purine nucleoside binding
    adenyl nucleotide binding
    adenyl ribonucleotide binding
    ATP binding
    catalytic activity
    acid-amino acid ligase activity
    ligase activity
    tetrahydrofolylpolyglutamate synthase activity
    ligase activity, forming carbon-nitrogen bonds
    Process
    folic acid and derivative biosynthetic process
    biosynthetic process
    cellular metabolic process
    cellular aromatic compound metabolic process
    metabolic process
    folic acid and derivative metabolic process
    Gene Properties
    Chromosome Location: chromosome 11
    Locus: YKL132C Link_out
    Gene Sequence:
    >1293 bp
    ATGGATGATATAAGCGGAAGGCAAACTTTACCTCGAATAAACCGTTTGTTGGAGCACGTG
    GGAAATCCCCAAGATAGTTTGTCAATCCTACATATAGCGGGAACAAATGGTAAGGAGACA
    GTATCTAAATTTTTGACATCCATATTGCAGCATCCGGGGCAACAGCGGCAAAGGGTCTTG
    ATTGGTAGGTATACTACATCTTCCTTGCTAAACGCCAAAGAAGAGGATATTAGCATTAAT
    AATGAAGCCATTTCCTTGATAGAGTATTCTAGGATCGAGAAGGAACTTATAGAAGCAGAT
    AGTTCTTTGAAATTACAGTGCAACAACCTCGAACTGCTAACAAGCGTAGCTCTCGTATAC
    TTCGCTAAGAAAAATTGCCAATGGTGCATAATAGAAACTGGTTTAGCTGGAAAACAGGAC
    CCTGGAAGTATAATTGCTGGTCAAAGTAGAGTCTGTTGCGCCATTACTAACGTGGGCATT
    AGCGATGAAGCTTTTTTATGCAAGTTTTTGTCTCAAATTACTGAAAGTTCCACAAATAAA
    GCAATTTTTCTATTAGACGGTTCTAATGACGAATTTGTACGAAATACGATAACGAAACGG
    TGCCATGATGTTGGATGTCCATTAGAAATCACCGACCCTTCTCTTAGGGATTACAATGTA
    CACACAGACACATGGGGCACTCTTGAAGTTCGCCTGCCATACAGTGAAGAAGAATATCAA
    ATATTTAATTTGAGAGTTGCGATAGCGGTTTTAGACTTTTTGAGCAAGGAAAAAAAGGTT
    TGTATTTCAAAGGATCAACTATCCCAAGGTTTAATATCTGTGGATTGGCCAAGAAGTTTA
    CATCGCTTGGATTACTGTTATGAATCTACTAGTGGAAAGAAAATCGCATTACTATTAGAC
    AACGCAAATAATGCGAAGGCAGCTCGAAATTTAGCCTGCCATTTAAGGACCACGTACGGT
    GATACGCCATTAACATTTGTCATTGCTATAACAACTGGGAAAAAGGTGTCTCCCTTACTT
    GATCCGCTAATACGTCCACAAGATTATGTTATTGTGACTAGATTTGGGTCAGTGGTTGGA
    ATGCCGTGGATCCAATCCCTAGAACCGGTGAATCTTCTCGCATTTATCAAAAACCGGTAT
    ACGAGAAATGTTAACATGCAGCCGGATCTTCAAAGTGTCTGGACCTTCCTTGAAACAAGT
    GGGTTAAAGACGATTGTTCCTGTTATCGTATGTGGATCACTGTATATCTGCAAAGAGCTA
    TTGCGCTTACACAACTGTCACTTGCCAGTATAG
    Protein Properties
    Pfam Domain Function: Not Available
    Protein Residues: 430
    Protein Molecular Weight: 48142.89844
    Protein Theoretical pI: 7.16
    Signalling Regions:
    • None
    Transmembrane Regions:
    • None
    Protein Sequence:
    >Probable folylpolyglutamate synthase
    MDDISGRQTLPRINRLLEHVGNPQDSLSILHIAGTNGKETVSKFLTSILQHPGQQRQRVL
    IGRYTTSSLLNAKEEDISINNEAISLIEYSRIEKELIEADSSLKLQCNNLELLTSVALVY
    FAKKNCQWCIIETGLAGKQDPGSIIAGQSRVCCAITNVGISDEAFLCKFLSQITESSTNK
    AIFLLDGSNDEFVRNTITKRCHDVGCPLEITDPSLRDYNVHTDTWGTLEVRLPYSEEEYQ
    IFNLRVAIAVLDFLSKEKKVCISKDQLSQGLISVDWPRSLHRLDYCYESTSGKKIALLLD
    NANNAKAARNLACHLRTTYGDTPLTFVIAITTGKKVSPLLDPLIRPQDYVIVTRFGSVVG
    MPWIQSLEPVNLLAFIKNRYTRNVNMQPDLQSVWTFLETSGLKTIVPVIVCGSLYICKEL
    LRLHNCHLPV
    References
    External Links:
    Resource Link
    Saccharomyces Genome Database: RMA1 Link_out
    Uniprot ID: P36001 Link_out
    Uniprot Name: FOLC_YEAST Link_out
    GenBank Gene ID: Z28131 Link_out
    Genebank Protein ID: 486223 Link_out
    General Reference:
    • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378. Pubmed: 8196765 Link_out
    • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212. Pubmed: 14576278 Link_out