You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable folylpolyglutamate synthase
Synonyms
  • Folylpoly-gamma-glutamate synthetase
  • FPGS
  • Tetrahydrofolylpolyglutamate synthase
  • Tetrahydrofolate synthase
Gene NameRMA1
Enzyme Class
Biological Properties
General FunctionInvolved in tetrahydrofolylpolyglutamate synthase activity
Specific FunctionConversion of folates to polyglutamate derivatives
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG Pathways
Folate biosynthesisec00790 Map00790
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00271L-Glutamic acidShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
catalytic activity
adenyl ribonucleotide binding
ATP binding
ligase activity
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
tetrahydrofolylpolyglutamate synthase activity
Process
cellular metabolic process
folic acid and derivative biosynthetic process
metabolic process
cellular aromatic compound metabolic process
biosynthetic process
folic acid and derivative metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL132C
Gene Sequence>1293 bp ATGGATGATATAAGCGGAAGGCAAACTTTACCTCGAATAAACCGTTTGTTGGAGCACGTG GGAAATCCCCAAGATAGTTTGTCAATCCTACATATAGCGGGAACAAATGGTAAGGAGACA GTATCTAAATTTTTGACATCCATATTGCAGCATCCGGGGCAACAGCGGCAAAGGGTCTTG ATTGGTAGGTATACTACATCTTCCTTGCTAAACGCCAAAGAAGAGGATATTAGCATTAAT AATGAAGCCATTTCCTTGATAGAGTATTCTAGGATCGAGAAGGAACTTATAGAAGCAGAT AGTTCTTTGAAATTACAGTGCAACAACCTCGAACTGCTAACAAGCGTAGCTCTCGTATAC TTCGCTAAGAAAAATTGCCAATGGTGCATAATAGAAACTGGTTTAGCTGGAAAACAGGAC CCTGGAAGTATAATTGCTGGTCAAAGTAGAGTCTGTTGCGCCATTACTAACGTGGGCATT AGCGATGAAGCTTTTTTATGCAAGTTTTTGTCTCAAATTACTGAAAGTTCCACAAATAAA GCAATTTTTCTATTAGACGGTTCTAATGACGAATTTGTACGAAATACGATAACGAAACGG TGCCATGATGTTGGATGTCCATTAGAAATCACCGACCCTTCTCTTAGGGATTACAATGTA CACACAGACACATGGGGCACTCTTGAAGTTCGCCTGCCATACAGTGAAGAAGAATATCAA ATATTTAATTTGAGAGTTGCGATAGCGGTTTTAGACTTTTTGAGCAAGGAAAAAAAGGTT TGTATTTCAAAGGATCAACTATCCCAAGGTTTAATATCTGTGGATTGGCCAAGAAGTTTA CATCGCTTGGATTACTGTTATGAATCTACTAGTGGAAAGAAAATCGCATTACTATTAGAC AACGCAAATAATGCGAAGGCAGCTCGAAATTTAGCCTGCCATTTAAGGACCACGTACGGT GATACGCCATTAACATTTGTCATTGCTATAACAACTGGGAAAAAGGTGTCTCCCTTACTT GATCCGCTAATACGTCCACAAGATTATGTTATTGTGACTAGATTTGGGTCAGTGGTTGGA ATGCCGTGGATCCAATCCCTAGAACCGGTGAATCTTCTCGCATTTATCAAAAACCGGTAT ACGAGAAATGTTAACATGCAGCCGGATCTTCAAAGTGTCTGGACCTTCCTTGAAACAAGT GGGTTAAAGACGATTGTTCCTGTTATCGTATGTGGATCACTGTATATCTGCAAAGAGCTA TTGCGCTTACACAACTGTCACTTGCCAGTATAG
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues430
Protein Molecular Weight48142.89844
Protein Theoretical pI7.16
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable folylpolyglutamate synthase MDDISGRQTLPRINRLLEHVGNPQDSLSILHIAGTNGKETVSKFLTSILQHPGQQRQRVL IGRYTTSSLLNAKEEDISINNEAISLIEYSRIEKELIEADSSLKLQCNNLELLTSVALVY FAKKNCQWCIIETGLAGKQDPGSIIAGQSRVCCAITNVGISDEAFLCKFLSQITESSTNK AIFLLDGSNDEFVRNTITKRCHDVGCPLEITDPSLRDYNVHTDTWGTLEVRLPYSEEEYQ IFNLRVAIAVLDFLSKEKKVCISKDQLSQGLISVDWPRSLHRLDYCYESTSGKKIALLLD NANNAKAARNLACHLRTTYGDTPLTFVIAITTGKKVSPLLDPLIRPQDYVIVTRFGSVVG MPWIQSLEPVNLLAFIKNRYTRNVNMQPDLQSVWTFLETSGLKTIVPVIVCGSLYICKEL LRLHNCHLPV
References
External Links
ResourceLink
Saccharomyces Genome Database RMA1
Uniprot IDP36001
Uniprot NameFOLC_YEAST
GenBank Gene IDZ28131
Genebank Protein ID486223
General Reference
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278