You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameThiamine pyrophosphokinase
Synonyms
  • TPK
  • Thiamine kinase
Gene NameTHI80
Enzyme Class
Biological Properties
General FunctionInvolved in thiamine diphosphokinase activity
Specific FunctionEssential protein, it is the only enzyme in yeast capable of synthesizing thiamine pyrophosphate (TPP)
Cellular LocationNot Available
SMPDB Pathways
Vitamin B1/Thiamine metabolismPW002486 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Thiamine metabolismec00730 Map00730
SMPDB Reactions
Thiamine + Adenosine triphosphatehydron + Adenosine monophosphate + Thiamine pyrophosphate
KEGG Reactions
Adenosine triphosphate + ThiamineAdenosine monophosphate + thiamine(1+) diphosphate(1-) + hydron
Adenosine triphosphate + thiamine(1+) diphosphate(1-)Thiamine triphosphate + ADP
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00220ThiamineShow
YMDB00381Thiamine pyrophosphateShow
YMDB00775Thiamine triphosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
diphosphotransferase activity
catalytic activity
thiamin diphosphokinase activity
transferase activity
Process
thiamin diphosphate biosynthetic process
metabolic process
thiamin and derivative metabolic process
thiamin metabolic process
cellular metabolic process
cellular aromatic compound metabolic process
cofactor metabolic process
coenzyme metabolic process
coenzyme biosynthetic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR143C
Gene Sequence>960 bp ATGAGCGAGGAGTGTATTGAAAATCCTGAACGTATTAAAATTGGTACTGATTTAATCAAC ATCCGAAATAAAATGAACTTAAAAGAACTAATCCATCCAAACGAGGATGAAAACTCTACC CTACTCATACTTAATCAAAAAATTGACATTCCTAGACCGTTGTTTTACAAAATTTGGAAG CTGCATGACTTGAAGGTCTGTGCAGATGGTGCAGCCAATAGATTATATGACTACCTAGAT GATGACGAAACCCTAAGGATAAAATATCTTCCCAATTATATTATTGGCGATCTGGATTCA CTATCAGAAAAGGTTTACAAGTATTATAGGAAAAACAAAGTAACTATAATAAAACAAACT ACACAATATTCGACTGATTTCACGAAGTGCGTTAATTTGATCTCTCTACACTTCAATTCA CCAGAATTTCGTTCTTTAATATCGAATAAAGACAATCTTCAGTCAAATCATGGAATTGAA CTGGAAAAGGGTATTCACACATTATACAATACTATGACCGAGTCCTTGGTTTTCTCGAAA GTGACTCCAATTAGTCTATTAGCACTAGGAGGAATTGGTGGTAGATTTGATCAGACGGTT CACTCAATAACGCAATTGTATACCTTATCCGAGAATGCAAGCTATTTCAAGCTTTGTTAC ATGACTCCAACAGACTTAATATTCTTAATCAAAAAAAATGGAACTTTGATTGAGTATGAT CCCCAATTTAGGAACACTTGTATAGGAAATTGTGGGTTGTTGCCTATTGGAGAGGCTACT TTGGTTAAGGAAACCCGTGGTTTAAAGTGGGATGTTAAAAACTGGCCAACTAGCGTGGTC ACCGGAAGAGTCAGCAGTAGTAACAGATTTGTTGGGGATAATTGTTGTTTCATTGATACC AAAGATGACATCATTTTGAATGTAGAAATATTCGTTGATAAATTAATAGATTTTTTGTAA
Protein Properties
Pfam Domain Function
Protein Residues319
Protein Molecular Weight36615.69922
Protein Theoretical pI6.26
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Thiamine pyrophosphokinase MSEECIENPERIKIGTDLINIRNKMNLKELIHPNEDENSTLLILNQKIDIPRPLFYKIWK LHDLKVCADGAANRLYDYLDDDETLRIKYLPNYIIGDLDSLSEKVYKYYRKNKVTIIKQT TQYSTDFTKCVNLISLHFNSPEFRSLISNKDNLQSNHGIELEKGIHTLYNTMTESLVFSK VTPISLLALGGIGGRFDQTVHSITQLYTLSENASYFKLCYMTPTDLIFLIKKNGTLIEYD PQFRNTCIGNCGLLPIGEATLVKETRGLKWDVKNWPTSVVTGRVSSSNRFVGDNCCFIDT KDDIILNVEIFVDKLIDFL
References
External Links
ResourceLink
Saccharomyces Genome Database THI80
Uniprot IDP35202
Uniprot NameTHI80_YEAST
GenBank Gene IDD14417
Genebank Protein ID416427
PDB ID
1IG0
General Reference
  • Nosaka, K., Kaneko, Y., Nishimura, H., Iwashima, A. (1993). "Isolation and characterization of a thiamin pyrophosphokinase gene, THI80, from Saccharomyces cerevisiae." J Biol Chem 268:17440-17447.8394343
  • Voss, H., Benes, V., Andrade, M. A., Valencia, A., Rechmann, S., Teodoru, C., Schwager, C., Paces, V., Sander, C., Ansorge, W. (1997). "DNA sequencing and analysis of 130 kb from yeast chromosome XV." Yeast 13:655-672.9200815
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Baker, L. J., Dorocke, J. A., Harris, R. A., Timm, D. E. (2001). "The crystal structure of yeast thiamin pyrophosphokinase." Structure 9:539-546.11435118