You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable trehalase
Synonyms
  • Alpha,alpha-trehalase
  • Alpha,alpha-trehalose glucohydrolase
Gene NameNTH2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionAlpha,alpha-trehalose + H(2)O = 2 D-glucose
Cellular LocationCytoplasmic
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Trehalose + waterD-Glucose
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00008TrehaloseShow
YMDB00286D-GlucoseShow
YMDB00890waterShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
ion binding
cation binding
metal ion binding
hydrolase activity
calcium ion binding
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
trehalase activity
alpha,alpha-trehalase activity
catalytic activity
binding
Process
trehalose metabolic process
primary metabolic process
carbohydrate metabolic process
trehalose catabolic process
metabolic process
oligosaccharide metabolic process
disaccharide metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR001C
Gene Sequence>2343 bp ATGGTAGATTTTTTACCAAAAGTAACGGAAATAAATCCTCCATCCGAAGGTAATGATGGT GAAGATAACATAAAGCCACTTTCAAGTGGTTCAGAGCAGCGGCCGTTGAAAGAAGAGGGG CAACAAGGTGGTAGAAGACATCACCGGCGGTTGTCCTCTATGCATGAGTATTTTGACCCG TTTTCCAACGCAGAGGTCTATTATGGACCAATAACAGATCCAAGAAAACAGTCAAAAATT CATAGACTAAATAGAACCAGAACTATGAGTGTTTTCAATAAAGTTTCTGACTTCAAAAAC GGAATGAAGGATTATACCCTGAAAAGGAGGGGTTCTGAAGACGACAGCTTCCTCAGCAGC CAAGGTAACCGTAGATTTTATATTGATAATGTGGATCTCGCTTTAGATGAGCTGCTCGCT AGTGAGGACACAGACAAGAATCACCAAATTACCATAGAAGACACTGGGCCCAAAGTTATT AAAGTCGGGACGGCCAATTCCAACGGTTTCAAACATGTAAATGTTAGGGGAACATATATG CTTTCTAACTTGTTGCAGGAACTAACCATTGCAAAAAGTTTCGGACGACACCAAATATTT TTGGATGAGGCGCGTATAAATGAAAACCCTGTTGATAGATTATCAAGATTGATAACGACT CAATTTTGGACGAGTTTAACGAGAAGAGTTGATCTTTATAATATTGCAGAAATTGCTAGA GACTCAAAAATAGATACGCCAGGCGCTAAAAATCCAAGAATTTATGTTCCATATAACTGC CCAGAGCAGTACGAATTTTACATTCAGGCATCTCAAATGAACCCGTCCTTAAAACTTGAA GTGGAGTACTTACCAAAAGATATTACAGCAGAGTATGTTAAATCATTAAATGATACACCG GGTTTGTTAGCCCTGGCTATGGAAGAACACGTTAATCCATCTACTGGTGAAAGGTCCCTA GTTGGTTATCCTTATGCGGTACCTGGCGGTAGATTCAATGAATTGTATGGCTGGGATTCA TATTTAATGGCACTGGGACTCATAGAAAGTAATAAGGTTGATGTTGCAAGAGGTATGGTG GAGCATTTTATATTCGAAATTGATCACTATAGTAAAATTTTGAATGCTAATAGGAGTTAT TATCTTTGCAGATCTCAGCCACCATTCCTAACCGATATGGCTCTGCTCGTATTTGAAAAG ATAGGAGGTAAGAATAATCCAAACGCTATTCAGTTGTTAAAACGCGCGTTCAGAGCTGCT ATTAAAGAATATAAAGAGGTGTGGATGTCGAGCCCTAGGTTAGATTCTCTGACAGGGCTG TCTTGTTATCATTCTGATGGTATTGGTATCCCTCCGGAAACTGAACCAGATCATTTTGAT ACTATATTATTACCGTATGCTGAAAAGTACAATGTTACTCTGGAAAAGCTTAGGTACCTT TATAACGAAGGCATGATTAAAGAACCCAAACTGGATGCATTTTTTTTACATGATCGTGCC GTGAGAGAGTCAGGACATGACACGACTTATAGGTTTGAAGGTGTATGTGCATATTTAGCG ACAATTGATCTAAACTCCTTGCTCTATAAATATGAGAAAGATATTGCTTTCGTCATTAAG GAGTATTTTGGTAATGAATATAAAGATGAGAATGATGGAACGGTAACCGATTCTGAACAC TGGGAGGAGCTAGCTGAACTGAGGAAAACAAGGATTAATAAGTATATGTGGGACGAAGAT TCAGGGTTTTTCTTCTATTATAACACGAAACTGAAATGCAGAACGTCTTATGAGTCTGCA ACGACTTTTTGGAGTTTGTGGGCTGGTCTTGCAACTGAAGAGCAAGCAAAAATCACAGTA GAAAAAGCTCTTCCTCAGTTAGAAATGCTCGGCGGACTAGTTGCATGCACAGAAAAATCA AGAGGTCCTATTTCTATTGATAGACCGATCAGGCAATGGGATTATCCTTTTGGTTGGGCG CCGCACCAAATATTAGCCTGGAAAGGTTTATCTGCATATGGTTATCAACAAGTAGCTACA AGATTGGCTTATAGGTGGCTGTACATGATTACAAAATCATTTGTTGATTATAACGGAATG GTGGTAGAAAAATATGATGTGACAAGAGGGACTGATCCGCATCGCGTTGATGCGGAATAT GGTAATCAAGGTGCTGATTTTAAGGGCGTCGCTACAGAAGGCTTTGGTTGGGTGAACACA AGTTATTTGCTCGGATTGAAATATATGAATAATCATGCAAGAAGGGCTCTCGCTGCTTGT AGTCCACCATTGCCATTTTTCAATAGTTTGAAACCCTCTGAGAAAAAATTGTATTACCTA TAA
Protein Properties
Pfam Domain Function
Protein Residues780
Protein Molecular Weight89678.60156
Protein Theoretical pI6.43
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable trehalase MVDFLPKVTEINPPSEGNDGEDNIKPLSSGSEQRPLKEEGQQGGRRHHRRLSSMHEYFDP FSNAEVYYGPITDPRKQSKIHRLNRTRTMSVFNKVSDFKNGMKDYTLKRRGSEDDSFLSS QGNRRFYIDNVDLALDELLASEDTDKNHQITIEDTGPKVIKVGTANSNGFKHVNVRGTYM LSNLLQELTIAKSFGRHQIFLDEARINENPVDRLSRLITTQFWTSLTRRVDLYNIAEIAR DSKIDTPGAKNPRIYVPYNCPEQYEFYIQASQMNPSLKLEVEYLPKDITAEYVKSLNDTP GLLALAMEEHVNPSTGERSLVGYPYAVPGGRFNELYGWDSYLMALGLIESNKVDVARGMV EHFIFEIDHYSKILNANRSYYLCRSQPPFLTDMALLVFEKIGGKNNPNAIQLLKRAFRAA IKEYKEVWMSSPRLDSLTGLSCYHSDGIGIPPETEPDHFDTILLPYAEKYNVTLEKLRYL YNEGMIKEPKLDAFFLHDRAVRESGHDTTYRFEGVCAYLATIDLNSLLYKYEKDIAFVIK EYFGNEYKDENDGTVTDSEHWEELAELRKTRINKYMWDEDSGFFFYYNTKLKCRTSYESA TTFWSLWAGLATEEQAKITVEKALPQLEMLGGLVACTEKSRGPISIDRPIRQWDYPFGWA PHQILAWKGLSAYGYQQVATRLAYRWLYMITKSFVDYNGMVVEKYDVTRGTDPHRVDAEY GNQGADFKGVATEGFGWVNTSYLLGLKYMNNHARRALAACSPPLPFFNSLKPSEKKLYYL
References
External Links
ResourceLink
Saccharomyces Genome Database NTH2
Uniprot IDP35172
Uniprot NameTREB_YEAST
GenBank Gene IDZ26494
Genebank Protein ID403316
General Reference
  • Wolfe, K. H., Lohan, A. J. (1994). "Sequence around the centromere of Saccharomyces cerevisiae chromosome II: similarity of CEN2 to CEN4." Yeast 10 Suppl A:S41-S46.8091860
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Nwaka, S., Kopp, M., Holzer, H. (1995). "Expression and function of the trehalase genes NTH1 and YBR0106 in Saccharomyces cerevisiae." J Biol Chem 270:10193-10198.7730323
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956