You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name1-phosphatidylinositol-3-phosphate 5-kinase FAB1
Synonyms
  • Phosphatidylinositol-3-phosphate 5-kinase
  • Type III PIP kinase
  • PIPkin-III
Gene NameFAB1
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionThe PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2). Catalyzes the phosphorylation of phosphatidylinositol-3-phosphate on the fifth hydroxyl of the myo- inositol ring, to form phosphatidylinositol-3,5-bisphosphate. Required for endocytic-vacuolar pathway and nuclear migration. The product of the reaction it catalyzes functions as an important regulator of vacuole homeostasis perhaps by controlling membrane flux to and/or from the vacuole. Hyperosmotic shock-induced increase in the levels of PtdIns(3,5)P2 requires the presence of VAC7, VAC14, and/or FIG4
Cellular LocationVacuole membrane; Peripheral membrane protein. Endosome membrane; Peripheral membrane protein.
SMPDB Pathways
Inositol MetabolismPW002498 ThumbThumb?image type=greyscaleThumb?image type=simple
Inositol phosphate metabolismPW002495 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Inositol phosphate metabolismec00562 Map00562
SMPDB Reactions
1-phosphatidyl-1D-myo-inositol 4-phosphate + Adenosine triphosphate1-phosphatidyl-1D-myo-inositol 4,5-biphosphate + ADP
KEGG Reactions
Adenosine triphosphate + 1-phosphatidyl-1D-myo-inositol 3-phosphate + hydronADP + 1-phosphatidyl-1D-myo-inositol 3,5-bisphosphate
Adenosine triphosphate + 1-phosphatidyl-1D-myo-inositol 3-phosphate → ADP + 1-phosphatidyl-1D-myo-inositol 3,5-bisphosphate
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
YMDB162491-phosphatidyl-1D-myo-inositol 4-phosphate Show
YMDB162511-phosphatidyl-1D-myo-inositol 4,5-biphosphateShow
GO Classification
Component
Not Available
Function
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
lipid kinase activity
purine nucleoside binding
adenyl nucleotide binding
phosphatidylinositol phosphate kinase activity
adenyl ribonucleotide binding
ATP binding
ion binding
cation binding
metal ion binding
transition metal ion binding
kinase activity
catalytic activity
zinc ion binding
transferase activity
protein binding
Process
organophosphate metabolic process
macromolecule metabolic process
phospholipid metabolic process
protein metabolic process
glycerophospholipid metabolic process
phosphoinositide metabolic process
phosphatidylinositol metabolic process
cellular protein metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 6
LocusYFR019W
Gene Sequence>6837 bp ATGTCATCGGAAGAACCCCATGCATCTATATCCTTTCCAGATGGCTCACATGTCCGGTCG TCCTCCACTGGTACTTCATCTGTGAACACAATCGATGCTACCTTATCCAGACCGAACTAT ATTAAGAAACCGTCCCTGCACATTATGTCGACATCTACGACGTCGACTACGACGGATCTA GTGACAAACCCAATTCTGAGCAATATCTCCGTGCCAAAAATAAGCCCCCCCACATCATCC TCGATAGCAACAGCGACATCAACAAGTCACGTGACCGGCACTGCGTCGCATTCGAACATT AAAGCTAATGCTAACACTAGTACCAGCGTGAATAAGAAAAATTTGCCGCCAACAACTAGT GGGAGGATACCCTCTAGCACCATCAAGAGATATCCGAGTCGCTATAAGCCTTCTCACTCG CTGCAGCTGCCCATTAAGAACGACTCCAACTTTAAACGATCTAGCATATATGCCTCCAAA TCCACTGTTACTGCTATCCCCATTAGGAACAATCGGCCAATTTCCATGCAGAATTCCTAT GCGCGCACTCCTGACAGCGATCATGACGACGTTGGCGATGAAGTGTCTTCGATAAAGAGT GCCTCTTCTTCGTTGACCGCATCCCTGTCCAAGAGTTTCCTGTTCGCATTTTATAACAAC CGCAAGAAGGACAAGACCAGTAACAATGGTGTCCTCTCAAAGGAATATTGGATGAAGGAC GAGAGTTCTAAAGAATGTTTCAGTTGTGGTAAAACGTTTAACACTTTCAGAAGGAAACAC CACTGCAGGATATGCGGCCAAATTTTTTGCAGCAGTTGCACTCTCTTGATAGATGGTGAT CGATTCGGCTGTCATGCCAAGATGCGAGTATGTTACAATTGTTATGAGCATGCAGACACA TACGAGGACTCCAGTGATGAAGAGAATGATTCTACAATGCAATTGAATGAGCCAAGGTCT CGCTCTCGCTCTCGTTCTTCCAATACCAATCCATATTCTCATTCACATTCGCATTTGCAT CTCATTTCACAGGACAACCATAACGGTACCGATCTCCATGATCCAGTAGCAGCAACGGAT AACCCTCAACAGCAGAATGAGGTCTACCTATTAAATGACGATGACGTACAAAGTATAATG ACCTCAGGTGAAGATTCTAAATTGTTCATTTCTACACCCCCACCACCACCGAAGATGGCC ATCCCAGCAACAAAGCAAGGCGGATCGCTGGAAATCTCATTCGATTCGGAAAACGATAGG GCTTTGCATTATCAAGATGACAACCCCGGTCGCCATCATCACCTCGATTCCGTGCCCACA AGGTACACTATCAGAGATATGGACAATATATCACATTACGATACCAACTCTAATTCCACT TTGAGGCCACATTATAACACCAATAACAGCACTATTACCATCAACAACCTCAACAACACT ACTTCCAACAACAGCAACTATAACAATACCAATAGCAACAGCAACATCAATAATCCTGCG CATTCCTTAAGAAGGTCTATTTTCCATTATGTAAGCAGCAATAGTGTTAACAAGGACAGT AACAATAGCTCTGCAACACCCGCTTCGTCTGCACAGTCTTCTTCCATACTGGATCCTGCC AATCGTATTATCGGGAATTATGCTCATAGAAATTACAAGTTTAAATTCAACTACAATTCC AAAGGTCCTTCGCAACAAAATGACACGGCAAATGGAAATAATGATAATAATAATAATAAT AATAATAATAATAATAATAATAATAATAACAGTGCCAGCGGTATTGCTGACAACAATAAC ATTCCCTCAAACGACAATGGCACGACGTTCACTCTAGATAAGAAGAAAAGAAACCCACTG ACAAAATCTAAATCTACGTCCGCTTACCTAGAATATCCTCTAAACGAGGAAGACTCTTCT GAGGACGAAGGTTCCATGTCCATATATTCTGTATTGAATGATGACCATAAAACTGACAAT CCAATTAGATCAATGAGGAACTCCACAAAATCTTTTCAACGAGCGCAAGCTTCACTACAG CGGATGAGGTTTAGAAGGAAAAGTAAAAGCAAGCATTTTCCCAACAATTCGAAAAGTTCC ATTTATAGAGACTTAAATTTCTTGACCAATAGTACTCCCAATTTACTTTCTGTAGTAAGC GACGATAATCTATACGACGATTCTTCTCCTTTGCAAGACAAGGCCTCTTCATCCGCTGCA AGCAGACTCACTGACAGAAAATTCAGCAATAGCAGTGGCAGCAATAATAATAGCAATAGT AATAGCAATATCAACACCGATCCTTGGAAGAGAATCGCTAGTATATCGGGATTCAAACTG AAAAAGGAAAAAAAGAGAGAATTAAATGAAGTCTCTCTTTTACATATGCATGCCCTATTA AAACAATTATTGAATGATCAAGAAATTTCCAATCTTCAAGAATGGATAACCCTTCTAGAT GGCGCTTTGCGTAAAGTTTTAAGGACCATCCTGAACGCGAGGGATTTGAACACATTAGAT TTTAGACAAACTTACGTTAAGATAAAAAGAATTAGTGGTGGATCTCCTCAAAATTCAGAA TATATCGACGGGGTTGTCTTTTCGAAAGCATTGCCGTCGAAAACAATGCCACGGCATTTG AAAAACCCAAGGATACTATTAATCATGTTTCCACTGGAGTACCAAAAGAACAATAACCAC TTTCTAAGTATAGAGTCCGTCTTTAGGCAAGAGCGCGAATATTTGGATAAACTTGTTTCG AGATTAAAGTCATTACATCCTGATATTATATACGTCGGCGCCAATGTTAGTGGGTACGCG TTAGAACTATTAAATGACTCAGGCATTGTCGTACAGTTTAATATGAAACCACAAGTCATT GAAAGAATTGCCAAGCTAACAGAAGCAGATATTGCCATTTCTGTGGATAAGTTGGCTACG AATATTAAGATGGGTGAATGTGAAACTTTTGAAGTTAAAAGCTACATTTATGGAAACATC AGTAAAACATATACATTTCTTCGGGGCTGTAACCCAGAACTTGGTGGAACAATTTTGTTA AGAGGTGATAGTCTTGAAAACTTGAGAAAAATCAAACAAGTCTCTGAATTTATGGTCTAC GCAATTTTTTCATTGAAGTTGGAAAGTTCATTTTTTAACGATAATTTCATACAACTTTCT ACAGATGTTTATTTGAAGAGAGCTGAATCCAAAAAACTGCAAGTTTTCGAAGGTTATTTT GCAGATTTCTTGATCAAATTCAATAACAGGATTTTGACTGTATCACCAACGGTAGATTTC CCCATTCCCTTTTTATTGGAAAAAGCCAGAGGCTTGGAAAAGAAGCTCATAGAAAGGATC AATCAATATGAAAGCGAATCTGATTTAGATCGGCAAACGCAACTAAATATGCTTCAAGGC TTAGAATCGACTATCACTAAGAAACACTTAGGAAATTTAATAAAATTCCTGCATGAAATG GAAATTGAAAATTTAGAGCTTGAGTTTCAGAAGAGAAGTCGTCAATGGGAGGTTTCATAT TCATCATCACAGAACTTACTTGGTACGGGCTCACACCAGTCTATAACAGTTCTCTACTCA ATGGTTTCAACAAAGACTGCCACACCTTGCGTTGGCCCTCAAATTGTTACTATTGACTAT TTTTGGGACAGTGATATTTCCATTGGTCAGTTTATCGAGAACGTCGTGGGAACTGCCAGG TATCCCTGCCAACAAGGCTGTAATGGTCTGTATTTGGATCATTATAGAAGCTATGTTCAT GGGTCAGGAAAAGTAGACGTTTTAATCGAAAAATTCCAAACTAGATTACCAAAATTAAAA GATATTATCCTCACGTGGAGTTATTGTAAAAAATGTGGGACATCTACTCCGATTTTACAA ATTAGCGAAAAAACCTGGAATCATTCTTTCGGTAAATATTTAGAAGTCATGTTTTGGAGT TACAAAGATAGCGTGACAGGAATTGGGAAATGTCCTCATGATTTCACTAAAGATCATGTC AAATACTTTGGTTACAATGATTTAGTGGTTCGACTAGAATATTCTGATTTAGAAGTTCAT GAATTGATAACCCCACCACGCAAAATAAAATGGAAACCTCATATCGACATCAAACTGAAG GTGGAACTATACTATAAGATTCTGGAAAAGATCAATAATTTCTATGGGAGTGTCCTAAGT CGGTTGGAACGTATTAAATTGGATAGTATGACTAAAGATAAAGTTCTTAGTGGACAAGCT AAAATTATCGAATTGAAGAGCAATGCTACAGAGGAGCAAAAATTAATGTTGCAAGACCTG GATACTTTTTACGCAGATAGTCCTTGCGATCAACATTTACCATTGAACCTGGTTATCAAA TCTCTATACGATAAGGCTGTAAATTGGAACTCTACATTTGCGATATTTGCAAAAAGCTAT TTGCCTTCTGAAACTGATATTAGTCGTATCACGGCCAAGCAGCTGAAAAAACTGTTTTAC GATTCTTCAAGAAAAGACAGCGAAGACAAAAAATCACTTCATGATGAAAAGGCGAAGACG AGGAAACCAGAAAAGAACGAATTACCGTTAGAGGGATTGAAAGATGTCGAAAAGCCGAAA ATTGATAGCAAGAATACGACAGAGAATCGTGACAGAACGAACGAACCACAGAATGCCGTG ACGATAACCACTTTTAAAGACGACACTCCAATTATTCCAACAAGTGGTACTAGTCACTTG ACAGTTACACCTTCTGCATCGTCGGTTTCTTCTTCTTTGACCCCTCAAACCGAAGAACGT CCGCCAATAAGCAGAAGTGGAACAGGTATATCTATGACTCATGATAAAAGCACTAGACCT AACATAAGAAAAATGAGTAGTGATAGTAGTTTATGTGGACTAGCATCACTTGCTAATGAA TATAGTAAAAATAATAAGGTGAGTAAGCTAGCTACATTTTTCGATCAAATGCATTTTGAT GCCCTGTCGAAAGAATTTGAACTGGAACGTGAAAGGGAAAGATTACAACTTAATAAGGAT AAATACCAAGCCATACGATTACAAACATCCACACCAATTGTGGAAATTTATAAAAATGTC AAAGACGCAGTTGATGAACCGCTTCACTCTAGAAGTTCAGGCAATAATTTGTCATCTGCG AATGTTAAGACTTTGGAGGCACCTGTGGGAGAACATTCCCGGGCCAATAATTGTAATCCT CCTAATTTAGATCAAAACTTGGAAACTGAATTAGAAAATTCCATTAGCCAATGGGGAGAA AACATTTTGAACCCCTCTGGAAAGACCACCGCAAGTACTCATTTAAATTCTAAGCCAGTA GTAAAGGAAACTTCAGAAAATCCAAAGTCAATAGTTAGAGAATCAGATAATTCAAAGTCG GAGCCGCTTCCACCTGTAATAACAACAACAACTGTCAATAAGGTAGAATCCACTCCACAA CCTGAAAAATCATTATTGATGAAAACCTTGAGCAACTTTTGGGCAGATCGATCTGCGTAT TTGTGGAAACCCCTTGTTTATCCAACCTGTCCTTCGGAACACATTTTTACTGATAGTGAC GTTATAATCCGCGAAGATGAACCAAGTTCCTTGATCGCATTTTGCTTAAGTACTTCTGAC TATAGAAATAAAATGATGAACTTGAATGTCCAGCAACAACAGCAGCAGCAAACAGCAGAA GCTGCTCCTGCCAAAACAGGAGGAAACAGTGGAGGAACTACGCAAACCGGGGATCCTTCT GTTAACATTTCTCCCTCAGTTTCTACAACTTCTCATAATAAGGGGAGGGACTCAGAAATT TCATCCTTAGTAACCACCAAAGAGGGCTTGTTGAACACCCCTCCCATTGAAGGCGCCCGA GATAGGACCCCACAAGAATCACAAACGCATTCCCAAGCAAATTTAGATACTCTTCAAGAA TTAGAGAAAATTATGACAAAAAAAACAGCCACACACTTGAGATATCAATTTGAGGAGGGT TTAACGGTAATGTCATGTAAAATTTTCTTCACAGAACATTTTGACGTGTTTAGAAAGATT TGTGATTGTCAAGAAAACTTCATTCAAAGTTTGTCAAGATGTGTTAAATGGGATTCCAAT GGGGGGAAAAGTGGGAGCGGGTTTTTAAAGACTTTGGATGATAGATTTATTATAAAGGAG CTGTCACACGCAGAACTGGAAGCCTTCATAAAATTTGCACCAAGTTATTTTGAATACATG GCACAAGCAATGTTCCATGATTTGCCCACGACTTTGGCTAAAGTATTTGGGTTTTATCAA ATTCAAGTAAAAAGCTCTATTTCAAGTTCCAAAAGTTATAAAATGGACGTTATCATTATG GAGAACTTATTTTATGAGAAGAAAACAACAAGAATATTTGATTTGAAGGGTTCCATGAGA AATAGACATGTCGAACAAACAGGTAAAGCTAATGAAGTGTTGTTGGATGAAAATATGGTA GAGTATATTTACGAATCACCTATTCATGTTCGCGAATATGACAAGAAACTTTTAAGAGCT TCTGTTTGGAACGACACATTATTTTTGGCCAAAATGAATGTGATGGATTATTCCTTAGTC ATTGGTATTGACAATGAAGGGTATACTTTGACAGTAGGAATCATTGATTTCATTCGAACG TTTACATGGGACAAAAAACTAGAAAGTTGGGTCAAAGAGAAAGGCCTAGTAGGGGGGGCC AGTGTGATCAAGCAGCCTACCGTTGTTACACCAAGACAATATAAAAAACGTTTTAGGGAA GCAATGGAGAGGTATATTTTGATGGTTCCTGATCCGTGGTATTGGGAAGGAAATTAA
Protein Properties
Pfam Domain Function
Protein Residues2278
Protein Molecular Weight257447.0
Protein Theoretical pI8.51
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>1-phosphatidylinositol-3-phosphate 5-kinase FAB1 MSSEEPHASISFPDGSHVRSSSTGTSSVNTIDATLSRPNYIKKPSLHIMSTSTTSTTTDL VTNPILSNISVPKISPPTSSSIATATSTSHVTGTASHSNIKANANTSTSVNKKNLPPTTS GRIPSSTIKRYPSRYKPSHSLQLPIKNDSNFKRSSIYASKSTVTAIPIRNNRPISMQNSY ARTPDSDHDDVGDEVSSIKSASSSLTASLSKSFLFAFYNNRKKDKTSNNGVLSKEYWMKD ESSKECFSCGKTFNTFRRKHHCRICGQIFCSSCTLLIDGDRFGCHAKMRVCYNCYEHADT YEDSSDEENDSTMQLNEPRSRSRSRSSNTNPYSHSHSHLHLISQDNHNGTDLHDPVAATD NPQQQNEVYLLNDDDVQSIMTSGEDSKLFISTPPPPPKMAIPATKQGGSLEISFDSENDR ALHYQDDNPGRHHHLDSVPTRYTIRDMDNISHYDTNSNSTLRPHYNTNNSTITINNLNNT TSNNSNYNNTNSNSNINNPAHSLRRSIFHYVSSNSVNKDSNNSSATPASSAQSSSILDPA NRIIGNYAHRNYKFKFNYNSKGPSQQNDTANGNNDNNNNNNNNNNNNNNNSASGIADNNN IPSNDNGTTFTLDKKKRNPLTKSKSTSAYLEYPLNEEDSSEDEGSMSIYSVLNDDHKTDN PIRSMRNSTKSFQRAQASLQRMRFRRKSKSKHFPNNSKSSIYRDLNFLTNSTPNLLSVVS DDNLYDDSSPLQDKASSSAASRLTDRKFSNSSGSNNNSNSNSNINTDPWKRIASISGFKL KKEKKRELNEVSLLHMHALLKQLLNDQEISNLQEWITLLDGALRKVLRTILNARDLNTLD FRQTYVKIKRISGGSPQNSEYIDGVVFSKALPSKTMPRHLKNPRILLIMFPLEYQKNNNH FLSIESVFRQEREYLDKLVSRLKSLHPDIIYVGANVSGYALELLNDSGIVVQFNMKPQVI ERIAKLTEADIAISVDKLATNIKMGECETFEVKSYIYGNISKTYTFLRGCNPELGGTILL RGDSLENLRKIKQVSEFMVYAIFSLKLESSFFNDNFIQLSTDVYLKRAESKKLQVFEGYF ADFLIKFNNRILTVSPTVDFPIPFLLEKARGLEKKLIERINQYESESDLDRQTQLNMLQG LESTITKKHLGNLIKFLHEMEIENLELEFQKRSRQWEVSYSSSQNLLGTGSHQSITVLYS MVSTKTATPCVGPQIVTIDYFWDSDISIGQFIENVVGTARYPCQQGCNGLYLDHYRSYVH GSGKVDVLIEKFQTRLPKLKDIILTWSYCKKCGTSTPILQISEKTWNHSFGKYLEVMFWS YKDSVTGIGKCPHDFTKDHVKYFGYNDLVVRLEYSDLEVHELITPPRKIKWKPHIDIKLK VELYYKILEKINNFYGSVLSRLERIKLDSMTKDKVLSGQAKIIELKSNATEEQKLMLQDL DTFYADSPCDQHLPLNLVIKSLYDKAVNWNSTFAIFAKSYLPSETDISRITAKQLKKLFY DSSRKDSEDKKSLHDEKAKTRKPEKNELPLEGLKDVEKPKIDSKNTTENRDRTNEPQNAV TITTFKDDTPIIPTSGTSHLTVTPSASSVSSSLTPQTEERPPISRSGTGISMTHDKSTRP NIRKMSSDSSLCGLASLANEYSKNNKVSKLATFFDQMHFDALSKEFELERERERLQLNKD KYQAIRLQTSTPIVEIYKNVKDAVDEPLHSRSSGNNLSSANVKTLEAPVGEHSRANNCNP PNLDQNLETELENSISQWGENILNPSGKTTASTHLNSKPVVKETSENPKSIVRESDNSKS EPLPPVITTTTVNKVESTPQPEKSLLMKTLSNFWADRSAYLWKPLVYPTCPSEHIFTDSD VIIREDEPSSLIAFCLSTSDYRNKMMNLNVQQQQQQQTAEAAPAKTGGNSGGTTQTGDPS VNISPSVSTTSHNKGRDSEISSLVTTKEGLLNTPPIEGARDRTPQESQTHSQANLDTLQE LEKIMTKKTATHLRYQFEEGLTVMSCKIFFTEHFDVFRKICDCQENFIQSLSRCVKWDSN GGKSGSGFLKTLDDRFIIKELSHAELEAFIKFAPSYFEYMAQAMFHDLPTTLAKVFGFYQ IQVKSSISSSKSYKMDVIIMENLFYEKKTTRIFDLKGSMRNRHVEQTGKANEVLLDENMV EYIYESPIHVREYDKKLLRASVWNDTLFLAKMNVMDYSLVIGIDNEGYTLTVGIIDFIRT FTWDKKLESWVKEKGLVGGASVIKQPTVVTPRQYKKRFREAMERYILMVPDPWYWEGN
References
External Links
ResourceLink
Saccharomyces Genome Database FAB1
Uniprot IDP34756
Uniprot NameFAB1_YEAST
GenBank Gene IDD50617
Genebank Protein ID836774
General Reference
  • Yamamoto, A., DeWald, D. B., Boronenkov, I. V., Anderson, R. A., Emr, S. D., Koshland, D. (1995). "Novel PI(4)P 5-kinase homologue, Fab1p, essential for normal vacuole function and morphology in yeast." Mol Biol Cell 6:525-539.7663021
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Cooke, F. T., Dove, S. K., McEwen, R. K., Painter, G., Holmes, A. B., Hall, M. N., Michell, R. H., Parker, P. J. (1998). "The stress-activated phosphatidylinositol 3-phosphate 5-kinase Fab1p is essential for vacuole function in S. cerevisiae." Curr Biol 8:1219-1222.9811604
  • Bonangelino, C. J., Nau, J. J., Duex, J. E., Brinkman, M., Wurmser, A. E., Gary, J. D., Emr, S. D., Weisman, L. S. (2002). "Osmotic stress-induced increase of phosphatidylinositol 3,5-bisphosphate requires Vac14p, an activator of the lipid kinase Fab1p." J Cell Biol 156:1015-1028.11889142
  • Gary, J. D., Sato, T. K., Stefan, C. J., Bonangelino, C. J., Weisman, L. S., Emr, S. D. (2002). "Regulation of Fab1 phosphatidylinositol 3-phosphate 5-kinase pathway by Vac7 protein and Fig4, a polyphosphoinositide phosphatase family member." Mol Biol Cell 13:1238-1251.11950935
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Duex, J. E., Tang, F., Weisman, L. S. (2006). "The Vac14p-Fig4p complex acts independently of Vac7p and couples PI3,5P2 synthesis and turnover." J Cell Biol 172:693-704.16492811
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Jin, N., Chow, C. Y., Liu, L., Zolov, S. N., Bronson, R., Davisson, M., Petersen, J. L., Zhang, Y., Park, S., Duex, J. E., Goldowitz, D., Meisler, M. H., Weisman, L. S. (2008). "VAC14 nucleates a protein complex essential for the acute interconversion of PI3P and PI(3,5)P(2) in yeast and mouse." EMBO J 27:3221-3234.19037259
  • Botelho, R. J., Efe, J. A., Teis, D., Emr, S. D. (2008). "Assembly of a Fab1 phosphoinositide kinase signaling complex requires the Fig4 phosphoinositide phosphatase." Mol Biol Cell 19:4273-4286.18653468
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956