You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePeroxisomal long-chain fatty acid import protein 1
Synonyms
  • Peroxisomal ABC transporter 2
Gene NamePXA2
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionInvolved in the import of activated long-chain fatty acids from the cytosol to the peroxisomal matrix
Cellular LocationPeroxisome membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00469hexadec-2-enoyl-CoAShow
YMDB00527palmitoyl-CoAShow
YMDB00528myristoyl-CoAShow
YMDB00538stearoyl-CoAShow
YMDB00539oleoyl-CoAShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00914ADPShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
hydrolase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
primary active transmembrane transporter activity
binding
P-P-bond-hydrolysis-driven transmembrane transporter activity
nucleoside binding
ATPase activity, coupled to transmembrane movement of substances
purine nucleoside binding
pyrophosphatase activity
adenyl nucleotide binding
nucleoside-triphosphatase activity
adenyl ribonucleotide binding
ATPase activity
ATP binding
nucleotide binding
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
catalytic activity
Process
establishment of localization
transport
transmembrane transport
Gene Properties
Chromosome Locationchromosome 11
LocusYKL188C
Gene Sequence>2562 bp ATGATCTCAACAGCTTCTGCATTTTATCAGAAGCATAGAGTAAATTTACTGCGTTCTTCA TACATAATATTGTTGCTAGCCACGCTTTACAATTCAAATTCCAGTTCTAGTAACAACAAA ACTGATAAGAAGGATTCTGAGTCAACGGTTTTAGAAAATAAGAAAATTGAAGAGGGAAAA GAAACCGCAGTAGATAGAGAGGAAGATGAAAGTAGCAAAGAAGAGTTAACGATAGTCTCC AAACATAGCACAGATTCAGAAGATGGTGCAATAATAATTGATAAAGAAAGCAAGACTAAT CATAAGGGGGGAGAGCGAAAAGGAAAGGTAGATTTTTTGTTCAAACTTTTGCTTCATGAT AAGAAGTGCCTCATTTTATTTATTACACAGGCTATTCTTCTGAACATCAGAACATTGCTG TCTCTTCGTGTGGCTACTTTAGATGGTCAATTAGTGTCCACACTAGTAAGAGCTCAATAC GCAAACTTCACAAAGATATTGTTGGGGAAATGGATGATCCTTGGAATTCCCGCCAGTTTT ATTAATTCACTGATCAGTTACACGACAAAACTTTGTGCTGTCACTATTAATAGGAAAGTT TCAGACTTTCTACTCTCAAAGTATCTATCTAATCACCATACTTTCTATTCCGTAGCTTCT GCTGAATCTGTTTCAGAAATTCAGGATAATTTGACAAAAGATATTTACACATTTTCAATG AACTCGTCATTATTACTGAATCAGCTATTAAAGCCAATGCTGGATTTGATCCTCTGTTCA TTCAAATTATTAACCTCAAACACTAGTGTTATGGGTGAAGGAACTTTGGCACTGGGCTTA ATTGTCTACGCCTCCAATTCATTACTAAAATTGATTCAACCGAATTTCACTAGGTTAACT ATGGCAAGCGCATCTTTGGAAAGTTGGTTCAGATCTTTACACTCGAATCTACATTCAAGC AATGAAGAAATTGCACTGCTAAGAGGGCAAAAGAGGGAACTAGAAAACGTTGATTATTCA TTTTACCGTTTGGTGCTATTTTTAAACAGAGAAATAAAGGCAAGAGCTATTTATGATGTT GCTACTGCATTTGTCATTAAATATACTTGGGGCGCAGCTGGCTTGGTACTATGCTCGATT CCAATATTTTTCAAAAACAAACCTAGTGAAGACACCTTACAGCTTAAGGAACCCGGGAAT GATATGACGGCTGATTTCATCACAAATAGAAGATTATTAGTCACTGCATCTAGCTCTATC GGAAGATTTGTGGAACTGAAGAGAAATATACAACAATTACGCGGTATCAGATTGAGATTG AACAAGTTCAATGATTTGTTGGATGCTAATAAAGGTGATGACGAAAAAGAACCAAGAGAT GAAAGGTGTATAGTGGAATATGATGATTCAAGGATAAAGTTTGAAAATATTCCTTTAATA ACACCTGCCAATCAAGTTCTAGTACCGGAGCTAAGTTTTGATCTGAAGCATGGAAATCAT CTACTAATTATTGGGCCCAACGGTTGCGGTAAATCTTCATTATTTCGTATTCTAGGCGGG CTTTGGCCGATAAGGGCGACTCCCAATAAAAATCATCAATCCAAGTTAATAATGCCGCGT AGAACTGTGGATAGAGATTGCGCAATATTTTATTTACCCCAAAGGCCGTATATGGGCAAT AGGTCGACATTCAGGGAACAGATTATTTATCCAGACAGTATTGAACAATTCAAAGAAAGA TATCACAATGATTATGATCTAGGCGATGCAGATTTAATAAAAATTCTGCAATTATTAGAT TTGGAGGATTTAGTCACTGAAAATATGTCACTTCTGCTGGCGCAAAGGACTTCCAAAAAT GATTCACAGCAGTTGTCGACGGAAGACAATCAGTCACCATGCGCCATTAAAGTTCGTGAT GCATTCAGTATAGTAAGAAATTGGTCCGAAGAATTAACAATTGGTGTCCAACAAAGGTTA GCTATGGCAAGGATGTACTATCATAAACCCAAGTTTGCTGTGCTCGACGAATGTACATCT GCAGTAGCCCCAGAAATGGAACAAAGGATGTACGAAAATGCGCAAAATTTTGGTATCTCG TTAATATCAGTTTGCCACAGGACAAGTTTATGGCATTTTCATAACTATCTGTTAAAATTT GATGGTAAAGGCGGATACCAATTTGGACCGTTTAACCCGAAGGAAAGGTTATGTAATGAA GAAAAACTTCTTGAACTAAATGCCATCTTGGATCAACAGGTGCCACTTTGGGAGCGGAAG TTGAAAGATCTGACAATTGCTAAAGAATCCAACATCATTCGTAAATCAGAAACTAACCTG AATCTTTTTGAAAAGATCGAAGATCCAAAAACGTCCAAATCTAATGCATTGTTTAATGCA AATAAAGGGCAGCGAATCACATCACCTACAGGGCAGGAGACTAGTAAGAGATTACCACTA TTTTCCCAACCATCTAGTTCAGCATCATCAAATTTACTAAGAAACAATAAAAGCTTGAAC AAAAAAGTTAAAACAAAAAAGGAAGAAGGAAAGGAGAGGTAA
Protein Properties
Pfam Domain Function
Protein Residues853
Protein Molecular Weight97125.29688
Protein Theoretical pI9.25
Signalling Regions
  • None
Transmembrane Regions
  • 122-142
  • 166-186
  • 269-289
  • 364-384
Protein Sequence>Peroxisomal long-chain fatty acid import protein 1 MISTASAFYQKHRVNLLRSSYIILLLATLYNSNSSSSNNKTDKKDSESTVLENKKIEEGK ETAVDREEDESSKEELTIVSKHSTDSEDGAIIIDKESKTNHKGGERKGKVDFLFKLLLHD KKCLILFITQAILLNIRTLLSLRVATLDGQLVSTLVRAQYANFTKILLGKWMILGIPASF INSLISYTTKLCAVTINRKVSDFLLSKYLSNHHTFYSVASAESVSEIQDNLTKDIYTFSM NSSLLLNQLLKPMLDLILCSFKLLTSNTSVMGEGTLALGLIVYASNSLLKLIQPNFTRLT MASASLESWFRSLHSNLHSSNEEIALLRGQKRELENVDYSFYRLVLFLNREIKARAIYDV ATAFVIKYTWGAAGLVLCSIPIFFKNKPSEDTLQLKEPGNDMTADFITNRRLLVTASSSI GRFVELKRNIQQLRGIRLRLNKFNDLLDANKGDDEKEPRDERCIVEYDDSRIKFENIPLI TPANQVLVPELSFDLKHGNHLLIIGPNGCGKSSLFRILGGLWPIRATPNKNHQSKLIMPR RTVDRDCAIFYLPQRPYMGNRSTFREQIIYPDSIEQFKERYHNDYDLGDADLIKILQLLD LEDLVTENMSLLLAQRTSKNDSQQLSTEDNQSPCAIKVRDAFSIVRNWSEELTIGVQQRL AMARMYYHKPKFAVLDECTSAVAPEMEQRMYENAQNFGISLISVCHRTSLWHFHNYLLKF DGKGGYQFGPFNPKERLCNEEKLLELNAILDQQVPLWERKLKDLTIAKESNIIRKSETNL NLFEKIEDPKTSKSNALFNANKGQRITSPTGQETSKRLPLFSQPSSSASSNLLRNNKSLN KKVKTKKEEGKER
References
External Links
ResourceLink
Saccharomyces Genome Database PXA2
Uniprot IDP34230
Uniprot NamePXA2_YEAST
GenBank Gene IDU93584
Genebank Protein ID1931633
General Reference
  • Shani, N., Valle, D. (1996). "A Saccharomyces cerevisiae homolog of the human adrenoleukodystrophy transporter is a heterodimer of two half ATP-binding cassette transporters." Proc Natl Acad Sci U S A 93:11901-11906.8876235
  • Wiemann, S., Voss, H., Schwager, C., Rupp, T., Stegemann, J., Zimmermann, J., Grothues, D., Sensen, C., Erfle, H., Hewitt, N., et, a. l. .. (1993). "Sequencing and analysis of 51.6 kilobases on the left arm of chromosome XI from Saccharomyces cerevisiae reveals 23 open reading frames including the FAS1 gene." Yeast 9:1343-1348.8154185
  • Bossier, P., Fernandes, L., Vilela, C., Rodrigues-Pousada, C. (1994). "The yeast YKL741 gene situated on the left arm of chromosome XI codes for a homologue of the human ALD protein." Yeast 10:681-686.7941751
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Hettema, E. H., van Roermund, C. W., Distel, B., van den Berg, M., Vilela, C., Rodrigues-Pousada, C., Wanders, R. J., Tabak, H. F. (1996). "The ABC transporter proteins Pat1 and Pat2 are required for import of long-chain fatty acids into peroxisomes of Saccharomyces cerevisiae." EMBO J 15:3813-3822.8670886