You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePeptidyl-tRNA hydrolase 2
Synonyms
  • PTH 2
Gene NamePTH2
Enzyme Class
Biological Properties
General FunctionInvolved in aminoacyl-tRNA hydrolase activity
Specific FunctionThe natural substrate for this enzyme may be peptidyl- tRNAs which drop off the ribosome during protein synthesis
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on ester bonds
carboxylesterase activity
aminoacyl-tRNA hydrolase activity
catalytic activity
Process
metabolic process
biosynthetic process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
Gene Properties
Chromosome Locationchromosome 2
LocusYBL057C
Gene Sequence>645 bp ATGATAACGTCCTTTTTAATGGAAAAGATGACAGTTTCTTCGAATTACACCATAGCTTTA TGGGCTACTTTCACCGCAATCTCCTTTGCCGTGGGTTACCAGTTGGGTACGTCGAACGCA TCATCAACTAAGAAATCCTCAGCTACTTTACTGCGTTCTAAAGAAATGAAGGAAGGAAAG CTACACAATGACACTGATGAGGAGGAAAGTGAAAGCGAAGATGAGAGCGATGAGGACGAA GATATTGAGTCCACTTCATTGAATGATATACCTGGAGAAGTTAGGATGGCATTGGTGATT CGTCAAGATCTTGGCATGACAAAGGGCAAAATAGCGGCACAATGCTGTCACGCAGCATTG TCATGTTTTAGACATATTGCTACAAACCCCGCGCGTGCTTCATACAACCCAATTATGACA CAAAGATGGCTAAATGCTGGACAGGCTAAAATAACGTTGAAATGTCCAGATAAGTTTACA ATGGACGAGTTGTATGCGAAGGCTATATCACTTGGGGTGAATGCAGCAGTTATTCATGAT GCTGGTAGAACACAGATTGCTGCGGGAAGTGCCACCGTATTGGGTTTAGGACCTGCTCCA AAAGCAGTATTGGATCAAATAACAGGTGATTTGAAATTGTATTGA
Protein Properties
Pfam Domain Function
Protein Residues214
Protein Molecular Weight23128.0
Protein Theoretical pI5.08
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Peptidyl-tRNA hydrolase 2 MITSFLMEKMTVSSNYTIALWATFTAISFAVGYQLGTSNASSTKKSSATLLRSKEMKEGK LHNDTDEEESESEDESDEDEDIESTSLNDIPGEVRMALVIRQDLGMTKGKIAAQCCHAAL SCFRHIATNPARASYNPIMTQRWLNAGQAKITLKCPDKFTMDELYAKAISLGVNAAVIHD AGRTQIAAGSATVLGLGPAPKAVLDQITGDLKLY
References
External Links
ResourceLink
Saccharomyces Genome Database PTH2
Uniprot IDP34222
Uniprot NamePTH2_YEAST
GenBank Gene IDAY692763
Genebank Protein ID51012977
General Reference
  • Scherens, B., el Bakkoury, M., Vierendeels, F., Dubois, E., Messenguy, F. (1993). "Sequencing and functional analysis of a 32,560 bp segment on the left arm of yeast chromosome II. Identification of 26 open reading frames, including the KIP1 and SEC17 genes." Yeast 9:1355-1371.8154187
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Rosas-Sandoval, G., Ambrogelly, A., Rinehart, J., Wei, D., Cruz-Vera, L. R., Graham, D. E., Stetter, K. O., Guarneros, G., Soll, D. (2002). "Orthologs of a novel archaeal and of the bacterial peptidyl-tRNA hydrolase are nonessential in yeast." Proc Natl Acad Sci U S A 99:16707-16712.12475929
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Fromant, M., Ferri-Fioni, M. L., Plateau, P., Blanquet, S. (2003). "Peptidyl-tRNA hydrolase from Sulfolobus solfataricus." Nucleic Acids Res 31:3227-3235.12799450
  • Hitchcock, A. L., Auld, K., Gygi, S. P., Silver, P. A. (2003). "A subset of membrane-associated proteins is ubiquitinated in response to mutations in the endoplasmic reticulum degradation machinery." Proc Natl Acad Sci U S A 100:12735-12740.14557538