You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSterol esterase TGL1
Synonyms
  • Triglyceride lipase-cholesterol esterase 1
Gene NameTGL1
Enzyme Class
Biological Properties
General FunctionInvolved in lipid metabolic process
Specific FunctionMediates the hydrolysis of steryl esters. Required for mobilization of steryl ester, thereby playing a central role in lipid metabolism. May have weak lipase activity toward triglycerides upon some conditions, however, the relevance of such activity is unclear in vivo
Cellular LocationMembrane; Single-pass type III membrane protein. Lipid droplet
SMPDB Pathways
Steroid biosynthesisPW002482 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolismPW002695 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolism TG(10:0/10:0/10:0)PW007514 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolism TG(10:0/10:0/12:0)PW007575 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolism TG(10:0/10:0/14:0)PW007576 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Steroid biosynthesisec00100 Map00100
SMPDB Reactions
TG(10:0/10:0/14:1(9Z)) + waterhydron + Palmitic acid + DG(10:0/14:1(9Z)/0:0)
TG(10:0/10:0/10:0) + waterhydron + Fatty Acid + DG(10:0/10:0/0:0)
TG(10:0/10:0/12:0) + waterhydron + Fatty Acid + DG(10:0/12:0/0:0)
TG(10:0/10:0/14:0) + waterhydron + Fatty Acid + DG(10:0/14:0/0:0)
TG(10:0/12:0/12:0) + waterhydron + Fatty Acid + DG(10:0/12:0/0:0)
KEGG Reactions
ergosterol + fatty acid ↔ ergosterol ester + water
24-methylidene-5alpha-cholest-8-en-3beta-ol + fatty acid ↔ fecosterol ester + water
zymosterol + fatty acid ↔ zymosterol ester + water
Metabolites
YMDB IDNameView
YMDB00069Palmitic acidShow
YMDB00543ergosterolShow
YMDB0054524-methylidene-5alpha-cholest-8-en-3beta-olShow
YMDB00548zymosterolShow
YMDB00809TG(16:0/16:0/16:0)Show
YMDB00825TrimyristinShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB01096TG(18:0/18:0/18:0)Show
YMDB01127DG(16:0/16:0/0:0)Show
YMDB01260TG(12:0/12:0/18:1(9Z))Show
YMDB01261TG(12:0/14:0/16:0)Show
YMDB01262TG(12:0/14:0/16:1(9Z))Show
YMDB01263TG(12:0/14:1(9Z)/16:1(9Z))Show
YMDB01265TG(12:0/16:0/16:0)Show
YMDB01266TG(12:0/16:0/16:1(9Z))Show
YMDB01267TG(12:0/16:0/18:1(9Z))Show
YMDB01268TG(12:0/16:1(9Z)/16:1(9Z))Show
YMDB01269TG(12:0/16:1(9Z)/18:1(9Z))Show
YMDB01271TG(14:0/16:0/16:0)Show
YMDB01272TG(14:0/16:0/16:1(9Z))Show
YMDB01274TG(14:0/16:1(9Z)/16:1(9Z))Show
YMDB01285TG(16:0/16:0/18:0)Show
YMDB12737DG(14:0/14:0/0:0)Show
YMDB15588TG(10:0/10:0/10:0)Show
YMDB15589TG(10:0/10:0/12:0)Show
YMDB15590TG(10:0/10:0/14:0)Show
YMDB15591TG(10:0/12:0/12:0)Show
YMDB15592TG(10:0/10:0/14:1(9Z))Show
YMDB15593TG(10:0/10:0/16:0)Show
YMDB15594TG(10:0/12:0/14:0)Show
YMDB15595TG(12:0/12:0/12:0)Show
YMDB15596TG(10:0/10:0/16:1(9Z))Show
YMDB15597TG(10:0/12:0/14:1(9Z))Show
YMDB15598TG(10:0/10:0/18:0)Show
YMDB15599TG(10:0/12:0/16:0)Show
YMDB15600TG(10:0/14:0/14:0)Show
YMDB15601TG(12:0/12:0/14:0)Show
YMDB15602TG(10:0/10:0/18:1(9Z))Show
YMDB15603TG(10:0/12:0/16:1(9Z))Show
YMDB15604TG(10:0/14:0/14:1(9Z))Show
YMDB15605TG(12:0/12:0/14:1(9Z))Show
YMDB15606TG(10:0/10:0/20:0)Show
YMDB15607TG(10:0/12:0/18:0)Show
YMDB15608TG(10:0/14:0/16:0)Show
YMDB15609TG(10:0/15:0/15:0)Show
YMDB15610TG(12:0/12:0/16:0)Show
YMDB15611TG(12:0/14:0/14:0)Show
YMDB15612TG(10:0/10:0/20:1(13Z))Show
YMDB15613TG(10:0/12:0/18:1(9Z))Show
YMDB15614TG(10:0/14:0/16:1(9Z))Show
YMDB15615TG(10:0/14:1(9Z)/16:0)Show
YMDB15616TG(10:0/15:0/15:1(9Z))Show
YMDB15617TG(12:0/12:0/16:1(9Z))Show
YMDB15618TG(12:0/14:0/14:1(9Z))Show
YMDB15619TG(10:0/14:1(9Z)/16:1(9Z))Show
YMDB15620TG(10:0/15:1(9Z)/15:1(9Z))Show
YMDB15621TG(12:0/14:1(9Z)/14:1(9Z))Show
YMDB15622TG(10:0/10:0/22:0)Show
YMDB15623TG(10:0/12:0/20:0)Show
YMDB15624TG(10:0/14:0/18:0)Show
YMDB15625TG(10:0/16:0/16:0)Show
YMDB15626TG(12:0/12:0/18:0)Show
YMDB15627TG(12:0/15:0/15:0)Show
YMDB15629TG(10:0/10:0/22:1(13Z))Show
YMDB15630TG(10:0/12:0/20:1(13Z))Show
YMDB15631TG(10:0/14:0/18:1(9Z))Show
YMDB15632TG(10:0/14:1(9Z)/18:0)Show
YMDB15633TG(10:0/16:0/16:1(9Z))Show
YMDB15634TG(12:0/14:1(9Z)/16:0)Show
YMDB15635TG(12:0/15:0/15:1(9Z))Show
YMDB15636TG(14:0/14:0/14:1(9Z))Show
YMDB15637TG(10:0/14:1(9Z)/18:1(9Z))Show
YMDB15638TG(10:0/16:1(9Z)/16:1(9Z))Show
YMDB15639TG(12:0/15:1(9Z)/15:1(9Z))Show
YMDB15640TG(14:0/14:1(9Z)/14:1(9Z))Show
YMDB15641TG(14:1(9Z)/14:1(9Z)/14:1(9Z))Show
YMDB15642TG(10:0/15:0/18:0)Show
YMDB15643TG(12:0/15:0/16:0)Show
YMDB15644TG(14:0/14:0/15:0)Show
YMDB15645TG(10:0/10:0/23:1(9Z))Show
YMDB15646TG(10:0/15:0/18:1(9Z))Show
YMDB15647TG(10:0/15:1(9Z)/18:0)Show
YMDB15648TG(12:0/15:0/16:1(9Z))Show
YMDB15649TG(12:0/15:1(9Z)/16:0)Show
YMDB15650TG(14:0/14:0/15:1(9Z))Show
YMDB15651TG(14:0/14:1(9Z)/15:0)Show
YMDB15652TG(10:0/15:1(9Z)/18:1(9Z))Show
YMDB15653TG(12:0/15:1(9Z)/16:1(9Z))Show
YMDB15654TG(14:0/14:1(9Z)/15:1(9Z))Show
YMDB15655TG(14:1(9Z)/14:1(9Z)/15:0)Show
YMDB15656TG(10:0/10:0/24:0)Show
YMDB15657TG(10:0/12:0/22:0)Show
YMDB15658TG(10:0/14:0/20:0)Show
YMDB15659TG(10:0/16:0/18:0)Show
YMDB15660TG(12:0/12:0/20:0)Show
YMDB15661TG(12:0/14:0/18:0)Show
YMDB15662TG(14:0/14:0/16:0)Show
YMDB15663TG(14:0/15:0/15:0)Show
YMDB15664TG(10:0/10:0/24:1(15Z))Show
YMDB15665TG(10:0/12:0/22:1(13Z))Show
YMDB15666TG(10:0/14:0/20:1(13Z))Show
YMDB15667TG(10:0/14:1(9Z)/20:0)Show
YMDB15668TG(10:0/16:0/18:1(9Z))Show
YMDB15669TG(10:0/16:1(9Z)/18:0)Show
YMDB15670TG(12:0/12:0/20:1(13Z))Show
YMDB15671TG(12:0/14:0/18:1(9Z))Show
YMDB15672TG(12:0/14:1(9Z)/18:0)Show
YMDB15673TG(14:0/14:0/16:1(9Z))Show
YMDB15674TG(14:0/14:1(9Z)/16:0)Show
YMDB15675TG(14:0/15:0/15:1(9Z))Show
YMDB15676TG(14:1(9Z)/15:0/15:0)Show
YMDB15677TG(10:0/14:1(9Z)/20:1(13Z))Show
YMDB15678TG(10:0/16:1(9Z)/18:1(9Z))Show
YMDB15679TG(12:0/14:1(9Z)/18:1(9Z))Show
YMDB15680TG(14:0/14:1(9Z)/16:1(9Z))Show
YMDB15681TG(14:0/15:1(9Z)/15:1(9Z))Show
YMDB15682TG(14:1(9Z)/14:1(9Z)/16:0)Show
YMDB15683TG(14:1(9Z)/15:0/15:1(9Z))Show
YMDB15684TG(10:0/10:0/25:0)Show
YMDB15685TG(10:0/15:0/20:0)Show
YMDB15686TG(12:0/15:0/18:0)Show
YMDB15687TG(14:0/15:0/16:0)Show
YMDB15688TG(15:0/15:0/15:0)Show
YMDB15689TG(10:0/10:0/25:1(15Z))Show
YMDB15690TG(10:0/12:0/23:1(9Z))Show
YMDB15691TG(10:0/15:0/20:1(13Z))Show
YMDB15692TG(10:0/15:1(9Z)/20:0)Show
YMDB15693TG(12:0/15:0/18:1(9Z))Show
YMDB15694TG(12:0/15:1(9Z)/18:0)Show
YMDB15695TG(14:0/15:0/16:1(9Z))Show
YMDB15696TG(14:0/15:1(9Z)/16:0)Show
YMDB15697TG(14:1(9Z)/15:0/16:0)Show
YMDB15698TG(15:0/15:0/15:1(9Z))Show
YMDB15699TG(10:0/15:1(9Z)/20:1(13Z))Show
YMDB15700TG(12:0/15:1(9Z)/18:1(9Z))Show
YMDB15701TG(14:0/15:1(9Z)/16:1(9Z))Show
YMDB15702TG(14:1(9Z)/15:0/16:1(9Z))Show
YMDB15703TG(14:1(9Z)/15:1(9Z)/16:0)Show
YMDB15704TG(15:0/15:1(9Z)/15:1(9Z))Show
YMDB15705TG(14:1(9Z)/15:1(9Z)/16:1(9Z))Show
YMDB15706TG(15:1(9Z)/15:1(9Z)/15:1(9Z))Show
YMDB15707TG(10:0/10:0/26:0)Show
YMDB15708TG(10:0/12:0/24:0)Show
YMDB15709TG(10:0/14:0/22:0)Show
YMDB15710TG(10:0/16:0/20:0)Show
YMDB15711TG(10:0/18:0/18:0)Show
YMDB15712TG(12:0/12:0/22:0)Show
YMDB15713TG(12:0/14:0/20:0)Show
YMDB15714TG(12:0/16:0/18:0)Show
YMDB15715TG(14:0/14:0/18:0)Show
YMDB15716TG(15:0/15:0/16:0)Show
YMDB15717TG(10:0/10:0/26:1(5Z))Show
YMDB15718TG(10:0/12:0/24:1(15Z))Show
YMDB15719TG(10:0/14:0/22:1(13Z))Show
YMDB15720TG(10:0/14:1(9Z)/22:0)Show
YMDB15721TG(10:0/16:0/20:1(13Z))Show
YMDB15722TG(10:0/16:1(9Z)/20:0)Show
YMDB15723TG(10:0/18:0/18:1(9Z))Show
YMDB15724TG(12:0/12:0/22:1(13Z))Show
YMDB15725TG(12:0/14:0/20:1(13Z))Show
YMDB15726TG(12:0/14:1(9Z)/20:0)Show
YMDB15727TG(12:0/16:1(9Z)/18:0)Show
YMDB15728TG(14:0/14:0/18:1(9Z))Show
YMDB15729TG(14:0/14:1(9Z)/18:0)Show
YMDB15730TG(14:1(9Z)/16:0/16:0)Show
YMDB15731TG(15:0/15:0/16:1(9Z))Show
YMDB15732TG(15:0/15:1(9Z)/16:0)Show
YMDB15733TG(10:0/14:1(9Z)/22:1(13Z))Show
YMDB15734TG(10:0/16:1(9Z)/20:1(13Z))Show
YMDB15735TG(10:0/18:1(9Z)/18:1(9Z))Show
YMDB15736TG(12:0/14:1(9Z)/20:1(13Z))Show
YMDB15737TG(14:0/14:1(9Z)/18:1(9Z))Show
YMDB15738TG(14:1(9Z)/14:1(9Z)/18:0)Show
YMDB15739TG(14:1(9Z)/16:0/16:1(9Z))Show
YMDB15740TG(15:0/15:1(9Z)/16:1(9Z))Show
YMDB15741TG(15:1(9Z)/15:1(9Z)/16:0)Show
YMDB15742TG(10:0/10:0/27:0)Show
YMDB15743TG(10:0/12:0/25:0)Show
YMDB15744TG(10:0/15:0/22:0)Show
YMDB15745TG(12:0/15:0/20:0)Show
YMDB15746TG(14:0/15:0/18:0)Show
YMDB15747TG(15:0/16:0/16:0)Show
YMDB15748TG(10:0/10:0/28:0)Show
YMDB15749TG(10:0/12:0/26:0)Show
YMDB15750TG(10:0/14:0/24:0)Show
YMDB15751TG(10:0/16:0/22:0)Show
YMDB15752TG(10:0/18:0/20:0)Show
YMDB15753TG(12:0/12:0/24:0)Show
YMDB15754TG(12:0/14:0/22:0)Show
YMDB15755TG(12:0/16:0/20:0)Show
YMDB15756TG(12:0/18:0/18:0)Show
YMDB15757TG(14:0/14:0/20:0)Show
YMDB15758TG(14:0/16:0/18:0)Show
YMDB15759TG(15:0/15:0/18:0)Show
YMDB15760TG(10:0/10:0/29:0)Show
YMDB15761TG(10:0/12:0/27:0)Show
YMDB15762TG(10:0/14:0/25:0)Show
YMDB15763TG(10:0/15:0/24:0)Show
YMDB15764TG(12:0/12:0/25:0)Show
YMDB15765TG(12:0/15:0/22:0)Show
YMDB15766TG(14:0/15:0/20:0)Show
YMDB15767TG(15:0/16:0/18:0)Show
YMDB15768TG(10:0/10:0/30:0)Show
YMDB15769TG(10:0/12:0/28:0)Show
YMDB15770TG(10:0/14:0/26:0)Show
YMDB15771TG(10:0/15:0/25:0)Show
YMDB15772TG(10:0/16:0/24:0)Show
YMDB15773TG(10:0/18:0/22:0)Show
YMDB15774TG(10:0/20:0/20:0)Show
YMDB15775TG(12:0/12:0/26:0)Show
YMDB15776TG(12:0/14:0/24:0)Show
YMDB15777TG(12:0/16:0/22:0)Show
YMDB15778TG(12:0/18:0/20:0)Show
YMDB15779TG(14:0/14:0/22:0)Show
YMDB15780TG(14:0/16:0/20:0)Show
YMDB15781TG(14:0/18:0/18:0)Show
YMDB15782TG(15:0/15:0/20:0)Show
YMDB15783TG(10:0/12:0/29:0)Show
YMDB15784TG(10:0/14:0/27:0)Show
YMDB15785TG(10:0/15:0/26:0)Show
YMDB15786TG(10:0/16:0/25:0)Show
YMDB15787TG(12:0/12:0/27:0)Show
YMDB15788TG(12:0/14:0/25:0)Show
YMDB15789TG(12:0/15:0/24:0)Show
YMDB15790TG(14:0/15:0/22:0)Show
YMDB15791TG(15:0/16:0/20:0)Show
YMDB15792TG(15:0/18:0/18:0)Show
YMDB15793TG(10:0/12:0/30:0)Show
YMDB15794TG(10:0/14:0/28:0)Show
YMDB15795TG(10:0/15:0/27:0)Show
YMDB15796TG(10:0/16:0/26:0)Show
YMDB15797TG(10:0/18:0/24:0)Show
YMDB15798TG(10:0/20:0/22:0)Show
YMDB15799TG(12:0/12:0/28:0)Show
YMDB15800TG(12:0/14:0/26:0)Show
YMDB15801TG(12:0/15:0/25:0)Show
YMDB15802TG(12:0/16:0/24:0)Show
YMDB15803TG(12:0/18:0/22:0)Show
YMDB15804TG(12:0/20:0/20:0)Show
YMDB15805TG(14:0/14:0/24:0)Show
YMDB15806TG(14:0/16:0/22:0)Show
YMDB15807TG(14:0/18:0/20:0)Show
YMDB15808TG(15:0/15:0/22:0)Show
YMDB15809TG(16:0/16:0/20:0)Show
YMDB15810TG(16:0/18:0/18:0)Show
YMDB15811TG(10:0/14:0/29:0)Show
YMDB15812TG(10:0/15:0/28:0)Show
YMDB15813TG(10:0/16:0/27:0)Show
YMDB15814TG(10:0/18:0/25:0)Show
YMDB15815TG(12:0/12:0/29:0)Show
YMDB15816TG(12:0/14:0/27:0)Show
YMDB15817TG(12:0/15:0/26:0)Show
YMDB15818TG(12:0/16:0/25:0)Show
YMDB15819TG(14:0/14:0/25:0)Show
YMDB15820TG(14:0/15:0/24:0)Show
YMDB15821TG(15:0/16:0/22:0)Show
YMDB15822TG(15:0/18:0/20:0)Show
YMDB15823TG(10:0/14:0/30:0)Show
YMDB15824TG(10:0/15:0/29:0)Show
YMDB15825TG(10:0/16:0/28:0)Show
YMDB15826TG(10:0/18:0/26:0)Show
YMDB15827TG(10:0/20:0/24:0)Show
YMDB15828TG(10:0/22:0/22:0)Show
YMDB15829TG(12:0/12:0/30:0)Show
YMDB15830TG(12:0/14:0/28:0)Show
YMDB15831TG(12:0/15:0/27:0)Show
YMDB15832TG(12:0/16:0/26:0)Show
YMDB15833TG(12:0/18:0/24:0)Show
YMDB15834TG(12:0/20:0/22:0)Show
YMDB15835TG(14:0/14:0/26:0)Show
YMDB15836TG(14:0/15:0/25:0)Show
YMDB15837TG(14:0/16:0/24:0)Show
YMDB15838TG(14:0/18:0/22:0)Show
YMDB15839TG(14:0/20:0/20:0)Show
YMDB15840TG(15:0/15:0/24:0)Show
YMDB15841TG(16:0/16:0/22:0)Show
YMDB15842TG(16:0/18:0/20:0)Show
YMDB15843TG(10:0/15:0/30:0)Show
YMDB15844TG(10:0/16:0/29:0)Show
YMDB15845TG(10:0/18:0/27:0)Show
YMDB15846TG(10:0/20:0/25:0)Show
YMDB15847TG(12:0/14:0/29:0)Show
YMDB15848TG(12:0/15:0/28:0)Show
YMDB15849TG(12:0/16:0/27:0)Show
YMDB15850TG(12:0/18:0/25:0)Show
YMDB15851TG(14:0/14:0/27:0)Show
YMDB15852TG(14:0/15:0/26:0)Show
YMDB15853TG(14:0/16:0/25:0)Show
YMDB15854TG(15:0/15:0/25:0)Show
YMDB15855TG(15:0/16:0/24:0)Show
YMDB15856TG(15:0/18:0/22:0)Show
YMDB15857TG(15:0/20:0/20:0)Show
YMDB15858TG(10:0/16:0/30:0)Show
YMDB15859TG(10:0/18:0/28:0)Show
YMDB15860TG(10:0/20:0/26:0)Show
YMDB15861TG(10:0/22:0/24:0)Show
YMDB15862TG(12:0/14:0/30:0)Show
YMDB15863TG(12:0/15:0/29:0)Show
YMDB15864TG(12:0/16:0/28:0)Show
YMDB15865TG(12:0/18:0/26:0)Show
YMDB15866TG(12:0/20:0/24:0)Show
YMDB15867TG(12:0/22:0/22:0)Show
YMDB15868TG(14:0/14:0/28:0)Show
YMDB15869TG(14:0/15:0/27:0)Show
YMDB15870TG(14:0/16:0/26:0)Show
YMDB15871TG(14:0/18:0/24:0)Show
YMDB15872TG(14:0/20:0/22:0)Show
YMDB15873TG(15:0/15:0/26:0)Show
YMDB15874TG(15:0/16:0/25:0)Show
YMDB15875TG(16:0/16:0/24:0)Show
YMDB15876TG(16:0/18:0/22:0)Show
YMDB15877TG(16:0/20:0/20:0)Show
YMDB15878TG(18:0/18:0/20:0)Show
YMDB15879TG(10:0/18:0/29:0)Show
YMDB15880TG(10:0/20:0/27:0)Show
YMDB15881TG(10:0/22:0/25:0)Show
YMDB15882TG(12:0/15:0/30:0)Show
YMDB15883TG(12:0/16:0/29:0)Show
YMDB15884TG(12:0/18:0/27:0)Show
YMDB15885TG(12:0/20:0/25:0)Show
YMDB15886TG(14:0/14:0/29:0)Show
YMDB15887TG(14:0/15:0/28:0)Show
YMDB15888TG(14:0/16:0/27:0)Show
YMDB15889TG(14:0/18:0/25:0)Show
YMDB15890TG(15:0/15:0/27:0)Show
YMDB15891TG(15:0/16:0/26:0)Show
YMDB15892TG(15:0/18:0/24:0)Show
YMDB15893TG(15:0/20:0/22:0)Show
YMDB15894TG(16:0/16:0/25:0)Show
GO Classification
Component
Not Available
Function
Not Available
Process
lipid metabolic process
metabolic process
primary metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL140W
Gene Sequence>1647 bp ATGTACTTCCCCTTTTTAGGCAGATTATCGATAACAGATTACATTATAGTCGTCTTGGTA TACATAGAAAGCATTATTTCATCAGTCCTTAAACTTATACCACAACCAATGATTAACCTT TTCGAATGGCTAATAAATTTCTCAACGTCCTCCGATGACAATACCATCGAAGAAAAGTTA AGGTCAGCTCCAACTATCCATGAAATGTGTGCAATTTTTGATATATCTGTCGAGGATCAT TTGGTAAGAACTGAAGACAATTATATCTTGACACTGCATAGAATCCCACCGATTTCTAAA AACAGATTTAACAATAAAGTGGTATACTTACATCACGGTCTTTTGATGTGTTCTGATGTT TGGTGTTGCAATATTGAAAGACATAAAAACTTACCGTTTGTATTGCATGATTTAGGTTAC GACGTCTGGATGGGAAATAATAGAGGTAATAAATATTCAACTGCCCACTTGAACAAACCA CCAAAATCGAACAAGTTTTGGGATTTTTCTATCGACGAATTTGCGTTCTTTGACATTCCA AACTCAATTGAATTCATCTTAGATATAACAAAAGTGGACAAGGTCATCTGCATCGGATTC TCTCAAGGCTCTGCTCAAATGTTTGCTGCATTTTCGTTGAGTGAAAAATTGAATCGAAAA GTCTCCCATTTTATAGCCATAGCACCCGCTATGACTCCAAAGGGGTTGCACAACAGAATT GTCGATACCTTGGCCAAATCATCGCCCGGCTTTATGTATCTTTTCTTTGGTAGGAAAATT GTGTTACCTTCAGCTGTCATTTGGCAAAGAACTTTACATCCAACACTTTTCAATTTGTGT ATCGATATCGCAAACAAGATACTGTTCAATTGGAAGTCGTTTAACATTCTACCGAGACAA AAGATTGCTTCTTACGCAAAACTTTATTCAACGACCAGTGTAAAATCCATTGTTCACTGG TTCCAAATATTAAGATCTCAGAAATTTCAAATGTTTGAAGAGTCTGATAACATGCTAAAT TCCTTAACTAGGCCTTACCAAATTGCTAATTTTCCTACTAGAACAAATATCAAGATTCCC ATTCTTTTAATTTATGGTGGCATAGATTCTTTAGTTGATATTGATGTGATGAAAAAAAAT CTACCCTTCAACTCCGTCTTTGATGTTAAAGTTGACAATTATGAACACCTGGATTTGATT TGGGGCAAAGATGCCGATACCTTGGTCATTGCTAAAGTCTTGAGGTTTATTGAATTTTTT AACCCTGGTAATGTTTCAGTGAAGACTAACCAGTTACTACCATCAGCAAGTCTGGTTGAG GAATTACCAAGCACGACATGGAAGACAACTCATCCAACGCATGGTCTCAGTTATAGAACT CACTCGGCAGACCGTTCTCCGTTGTCTGTACAAGCTGATGAAGCGGATGAGGTCCACAAT GCTGACAATTCAAGGTTCTTAAGACGAGTGTTTTCTACTAGTGCCATAGACGAGGACAAC GAAAATGAGCACCAGGATGATACAGAAGATCAAATCCATAAGGAGCAGCAAAGACGGTTA AGTGCCTATCTGGAATCATCCAAAGATTTACGACAACTAGATGCCAACTCTTCGACAACT GCGCTGGATGCTCTAAATAAAGAATGA
Protein Properties
Pfam Domain Function
Protein Residues548
Protein Molecular Weight62978.39844
Protein Theoretical pI6.83
Signalling Regions
  • None
Transmembrane Regions
  • 14-34
Protein Sequence>Sterol esterase TGL1 MYFPFLGRLSITDYIIVVLVYIESIISSVLKLIPQPMINLFEWLINFSTSSDDNTIEEKL RSAPTIHEMCAIFDISVEDHLVRTEDNYILTLHRIPPISKNRFNNKVVYLHHGLLMCSDV WCCNIERHKNLPFVLHDLGYDVWMGNNRGNKYSTAHLNKPPKSNKFWDFSIDEFAFFDIP NSIEFILDITKVDKVICIGFSQGSAQMFAAFSLSEKLNRKVSHFIAIAPAMTPKGLHNRI VDTLAKSSPGFMYLFFGRKIVLPSAVIWQRTLHPTLFNLCIDIANKILFNWKSFNILPRQ KIASYAKLYSTTSVKSIVHWFQILRSQKFQMFEESDNMLNSLTRPYQIANFPTRTNIKIP ILLIYGGIDSLVDIDVMKKNLPFNSVFDVKVDNYEHLDLIWGKDADTLVIAKVLRFIEFF NPGNVSVKTNQLLPSASLVEELPSTTWKTTHPTHGLSYRTHSADRSPLSVQADEADEVHN ADNSRFLRRVFSTSAIDEDNENEHQDDTEDQIHKEQQRRLSAYLESSKDLRQLDANSSTT ALDALNKE
References
External Links
ResourceLink
Saccharomyces Genome Database TGL1
Uniprot IDP34163
Uniprot NameTGL1_YEAST
GenBank Gene IDZ25464
Genebank Protein ID396439
General Reference
  • Abraham, P. R., Mulder, A., Van 't Riet, J., Planta, R. J., Raue, H. A. (1992). "Molecular cloning and physical analysis of an 8.2 kb segment of chromosome XI of Saccharomyces cerevisiae reveals five tightly linked genes." Yeast 8:227-238.1574929
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Athenstaedt, K., Zweytick, D., Jandrositz, A., Kohlwein, S. D., Daum, G. (1999). "Identification and characterization of major lipid particle proteins of the yeast Saccharomyces cerevisiae." J Bacteriol 181:6441-6448.10515935
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Ferreira, T., Regnacq, M., Alimardani, P., Moreau-Vauzelle, C., Berges, T. (2004). "Lipid dynamics in yeast under haem-induced unsaturated fatty acid and/or sterol depletion." Biochem J 378:899-908.14640980
  • Jandrositz, A., Petschnigg, J., Zimmermann, R., Natter, K., Scholze, H., Hermetter, A., Kohlwein, S. D., Leber, R. (2005). "The lipid droplet enzyme Tgl1p hydrolyzes both steryl esters and triglycerides in the yeast, Saccharomyces cerevisiae." Biochim Biophys Acta 1735:50-58.15922657
  • Koffel, R., Tiwari, R., Falquet, L., Schneiter, R. (2005). "The Saccharomyces cerevisiae YLL012/YEH1, YLR020/YEH2, and TGL1 genes encode a novel family of membrane-anchored lipases that are required for steryl ester hydrolysis." Mol Cell Biol 25:1655-1668.15713625
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956