You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NametRNA (uracil-5-)-methyltransferase
Synonyms
  • Transfer RNA methyltransferase 2
  • tRNA(M-5-U54)-methyltransferase
Gene NameTRM2
Enzyme Class
Biological Properties
General FunctionInvolved in RNA methyltransferase activity
Specific FunctionCatalyzes the formation of 5-methyl-uridine at position 54 (M-5-U54) in all tRNA. May also have a role in tRNA stabilization or maturation
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
RNA methyltransferase activity
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
RNA processing
Gene Properties
Chromosome Locationchromosome 11
LocusYKR056W
Gene Sequence>YKR056W TRM2 SGDID:S000001764, Chr XI from 549448-551367, Verified ORF, "tRNA methyltransferase, 5-methylates the uridine residue at position 54 of tRNAs and may also have a role in tRNA stabilization or maturation; endo-exonuclease with a role in DNA rep ATGTACGAACAGTTTGAATTTTCTTTTTTTTTCTTCGAAAATTCAGACAATAAGGTTAAA TATAAAGCTCATCTCATCTCATCGATAAAACGCTGGAGTATTATCACATGCATGCGTTGC TTTTGGACCGTACAGAAGTCTATATTTAAAGCTAGGTTTTTCGCTTGCAGAAACTTTGTC AAGAAGCATAATTATAAACTAATCAGCACCATGACTGGAAGTACTGAAATGGTACCACCA ACAATGAAACATACCGTTGACAACAAAAGGCTTTCGTCTCCTTTGACAGATTCTGGTAAC CGCCGGACTAAGAAGCCAAAGTTGAGAAAGTACAAGGCCAAAAAGGTTGAAACAACTTCT CCGATGGGTGTCCTAGAATTTGAAGTGAACGATTTGTTAAAATCTCAAAATTTGTCCAGG GAGCAGGTTCTGAACGATGTTACTTCAATTCTAAATGATAAGTCCTCAACAGATGGACCT ATCGTCTTACAATATCACCGAGAGGTAAAAAATGTCAAGGTCTTAGAAATTACTTCCAAT GGCAACGGGTTGGCTTTGATCGATAATCCTGTTGAAACAGAAAAGAAGCAAGTTGTTATC ATACCGTTTGGCCTGCCCGGTGATGTAGTTAATATCAAAGTCTTTAAGACCCACCCTTAC TATGTCGAGAGTGATTTATTAGACGTAGTGGAAAAATCTCCAATGAGAAGAGATGATTTA ATTAGGGATAAATATTTCGGGAAATCTTCAGGAAGTCAATTAGAGTTCTTAACTTACGAT GACCAACTAGAATTGAAAAGAAAAACAATTATGAATGCCTACAAGTTCTTCGCACCAAGG TTAGTTGCTGAAAAACTTTTACCCCCATTTGACACCACCGTAGCTTCCCCTTTACAATTT GGCTACAGGACCAAAATTACGCCTCATTTCGATATGCCAAAAAGAAAACAAAAGGAACTA TCAGTAAGGCCTCCTTTAGGATTTGGTCAAAAGGGTAGACCTCAATGGAGAAAAGATACT TTGGATATCGGCGGACATGGTTCGATATTAGATATCGATGAATGTGTGCTTGCAACTGAA GTTCTCAACAAAGGATTGACTAATGAAAGAAGAAAGTTTGAGCAAGAGTTTAAAAACTAC AAAAAAGGCGCGACTATTTTACTGAGAGAGAATACCACTATTTTAGACCCTTCCAAACCA ACTTTAGAACAGTTAACCGAAGAAGCCTCTAGGGATGAAAATGGTGATATAAGTTATGTC GAAGTCGAAGACAAAAAGAACAATGTCAGGCTGGCTAAAACTTGCGTTACCAATCCTAGA CAAATTGTCACTGAATATGTTGATGGATATACTTTTAATTTTAGTGCGGGTGAGTTTTTT CAAAATAATAACTCTATCCTGCCAATAGTGACCAAGTATGTCCGTGATAACTTGCAAGCT CCCGCTAAAGGTGATGATAATAAAACAAAGTTTCTAGTAGATGCTTATTGTGGATCAGGT CTTTTCAGTATATGCAGCTCCAAGGGCGTAGATAAAGTGATTGGTGTAGAAATTTCCGCT GACAGTGTCTCTTTTGCAGAAAAAAATGCAAAGGCAAATGGTGTTGAAAACTGTAGATTC ATCGTTGGAAAGGCTGAGAAACTCTTTGAGTCTATTGATACTCCAAGTGAAAACACTTCC GTTATCTTGGATCCACCACGCAAGGGCTGTGACGAATTATTCCTAAAGCAATTAGCCGCA TATAATCCAGCCAAGATTATTTACATATCGTGTAATGTCCATTCCCAGGCACGTGATGTC GAGTACTTCCTCAAAGAAACAGAAAACGGTTCCGCCCACCAGATTGAAAGCATAAGAGGA TTTGATTTCTTTCCACAAACGCACCACGTTGAGAGTGTGTGTATAATGAAGAGAATCTAA
Protein Properties
Pfam Domain Function
Protein Residues639
Protein Molecular Weight72851.79688
Protein Theoretical pI9.14
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>tRNA (uracil-5-)-methyltransferase MYEQFEFSFFFFENSDNKVKYKAHLISSIKRWSIITCMRCFWTVQKSIFKARFFACRNFV KKHNYKLISTMTGSTEMVPPTMKHTVDNKRLSSPLTDSGNRRTKKPKLRKYKAKKVETTS PMGVLEFEVNDLLKSQNLSREQVLNDVTSILNDKSSTDGPIVLQYHREVKNVKVLEITSN GNGLALIDNPVETEKKQVVIIPFGLPGDVVNIKVFKTHPYYVESDLLDVVEKSPMRRDDL IRDKYFGKSSGSQLEFLTYDDQLELKRKTIMNAYKFFAPRLVAEKLLPPFDTTVASPLQF GYRTKITPHFDMPKRKQKELSVRPPLGFGQKGRPQWRKDTLDIGGHGSILDIDECVLATE VLNKGLTNERRKFEQEFKNYKKGATILLRENTTILDPSKPTLEQLTEEASRDENGDISYV EVEDKKNNVRLAKTCVTNPRQIVTEYVDGYTFNFSAGEFFQNNNSILPIVTKYVRDNLQA PAKGDDNKTKFLVDAYCGSGLFSICSSKGVDKVIGVEISADSVSFAEKNAKANGVENCRF IVGKAEKLFESIDTPSENTSVILDPPRKGCDELFLKQLAAYNPAKIIYISCNVHSQARDV EYFLKETENGSAHQIESIRGFDFFPQTHHVESVCIMKRI
References
External Links
ResourceLink
Saccharomyces Genome Database TRM2
Uniprot IDP33753
Uniprot NameTRM2_YEAST
General Reference
  • Van Vliet-Reedijk, J. C., Planta, R. J. (1993). "The RHO4a and NUD1 genes on Saccharomyces cerevisiae chromosome XI." Yeast 9:1139-1147.8256523
  • Nordlund, M. E., Johansson, J. O., von Pawel-Rammingen, U., Bystrom, A. S. (2000). "Identification of the TRM2 gene encoding the tRNA(m5U54)methyltransferase of Saccharomyces cerevisiae." RNA 6:844-860.10864043
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Chow, T. Y., Perkins, E. L., Resnick, M. A. (1992). "Yeast RNC1 encodes a chimeric protein, RhoNUC, with a human rho motif and deoxyribonuclease activity." Nucleic Acids Res 20:5215-5221.1408836
  • Brachat, S., Dietrich, F. S., Voegeli, S., Zhang, Z., Stuart, L., Lerch, A., Gates, K., Gaffney, T., Philippsen, P. (2003). "Reinvestigation of the Saccharomyces cerevisiae genome annotation by comparison to the genome of a related fungus: Ashbya gossypii." Genome Biol 4:R45.12844361
  • Johansson, M. J., Bystrom, A. S. (2002). "Dual function of the tRNA(m(5)U54)methyltransferase in tRNA maturation." RNA 8:324-335.12003492
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956