You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable mannosyltransferase KTR2
SynonymsNot Available
Gene NameKTR2
Enzyme Class
Biological Properties
General FunctionInvolved in mannosyltransferase activity
Specific FunctionInvolved in N-linked glycosylation
Cellular LocationGolgi apparatus membrane; Single-pass type II membrane protein
SMPDB Pathways
N-Glycan biosynthesisPW002501 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
N-Glycan biosynthesisec00510 Map00510
SMPDB ReactionsNot Available
KEGG Reactions
Beta-1,4-D-Mannosylchitobiosyldiphosphodolichol + Guanosine diphosphate mannosealpha-D-mannosyl-beta-D-mannosyldiacetylchitobiosyldiphosphodolichol + hydron + Guanosine diphosphate
Metabolites
YMDB IDNameView
YMDB00202Guanosine diphosphate mannoseShow
YMDB00257Guanosine diphosphateShow
YMDB00581alpha-D-mannosyl-beta-D-mannosyldiacetylchitobiosyldiphosphodolicholShow
YMDB00862hydronShow
YMDB00935beta-D-mannosyldiacetylchitobiosyldiphosphodolicholShow
GO Classification
Component
cell part
membrane
Function
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring hexosyl groups
mannosyltransferase activity
alpha-1,2-mannosyltransferase activity
glycolipid 2-alpha-mannosyltransferase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
protein amino acid glycosylation
Gene Properties
Chromosome Locationchromosome 11
LocusYKR061W
Gene Sequence>1278 bp ATGCAAATCTGCAAGGTATTTCTTACACAGGTTAAAAAACTACTTTTTGTTAGTCTTCTA TTTTGCTTGATAGCTCAAACATGTTGGCTTGCACTTGTACCATATCAGAGACAGCTGAGC CTAGATTCGTATTTTTTTAGAAGATCTCGAGAAGTTTCATCGAGATATGATTTTACAAGG AGGCGACATATGAATCAGACGCTGAAGCTATCTAGCAACACTTATAATGATGAACCACTA AACAAGACCAAGGGAATAAAAAATCAAAGAGAAAATGCTACATTGTTAATGCTTGTGCGT AATTGGGAACTTTCGGGGGCACTCCGTTCCATGAGATCACTAGAAGACCGTTTCAATAAA AACTACCAGTATGACTGGACATTTCTTAATGATGTCCCATTTGATCAAGAGTTCATCGAA GCCACCACAGCCATGGCTAGTGGTAGAACGCAATACGCTTTAATCCCTGCGGAGGACTGG AACAGGCCATCTTGGATCAACGAAACTCTATTTGAAGAGGCTTTACAATTAATGGAGGAA AAAAATATCTTGTACGGTGGGTCAAAGTCATATAGAAATATGTGCCGATTTAATTCTGGA TTTTTCTTTAGACAAAAGATATTAGATCCGTACGATTTTTATTTCAGAGTTGAGCCAGAT GTAGAGTATTTTTGCGATTTTCCCTACGATCCATTCAAGGTGATGAGGCAGAACAATAAG AAATATGGCTTTGTGATAACTATGTATGAATACGAAGATACAATTCCGAGCCTATGGGAA GCTGTAGAAGAATATCTCGAAGAAACAGAGTCAGCAGATATTGACATGGAAAGCAACGCT TTCGGGTTCGTATCAAATTTCGACTTCATCGGTAAATCTTTTGGTGTCATCGATAGTAAC AGCGGCTATAATTTATGTCATTTTTGGACAAATTTTGAAATTGGCGATTTGAACTTTTTC AGAAGTGAGAAATACATTAGATTTTTCGAGTACTTGGATTCAAAGGGCGGTTTTTACTAT GAAAGGTGGGGAGATGCACCAGTTCATTCGATTGCTGCCTCACTTCTTTTGAAAAAAGAC GAAATCATCCATTTTGATGAATTAGGCTATAAGCATATGCCTTTTGGCACGTGTCCATCT GCATACTACCTGAGACTTCAACAAAGATGTCTTTGTGATAGCAATCACCCAGACAATATT GATCTCAATGTCATCAGCTGCCTGAGAAGATGGTGGAAGGACGGCAGCGGTAAATACTTC CTCAAACACGATTCATAG
Protein Properties
Pfam Domain Function
Protein Residues425
Protein Molecular Weight50650.89844
Protein Theoretical pI5.54
Signalling Regions
  • None
Transmembrane Regions
  • 14-33
Protein Sequence>Probable mannosyltransferase KTR2 MQICKVFLTQVKKLLFVSLLFCLIAQTCWLALVPYQRQLSLDSYFFRRSREVSSRYDFTR RRHMNQTLKLSSNTYNDEPLNKTKGIKNQRENATLLMLVRNWELSGALRSMRSLEDRFNK NYQYDWTFLNDVPFDQEFIEATTAMASGRTQYALIPAEDWNRPSWINETLFEEALQLMEE KNILYGGSKSYRNMCRFNSGFFFRQKILDPYDFYFRVEPDVEYFCDFPYDPFKVMRQNNK KYGFVITMYEYEDTIPSLWEAVEEYLEETESADIDMESNAFGFVSNFDFIGKSFGVIDSN SGYNLCHFWTNFEIGDLNFFRSEKYIRFFEYLDSKGGFYYERWGDAPVHSIAASLLLKKD EIIHFDELGYKHMPFGTCPSAYYLRLQQRCLCDSNHPDNIDLNVISCLRRWWKDGSGKYF LKHDS
References
External Links
ResourceLink
Saccharomyces Genome Database KTR2
Uniprot IDP33550
Uniprot NameKTR2_YEAST
GenBank Gene IDL17083
Genebank Protein ID311111
General Reference
  • Lussier, M., Camirand, A., Sdicu, A. M., Bussey, H. (1993). "KTR2: a new member of the KRE2 mannosyltransferase gene family." Yeast 9:1057-1063.8256512
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765