You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUrea active transporter
SynonymsNot Available
Gene NameDUR3
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transporter activity
Specific FunctionRequired for active transport of urea
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00003UreaShow
YMDB00232SpermidineShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
Function
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 8
LocusYHL016C
Gene Sequence>2208 bp ATGGGAGAATTTAAACCTCCGCTACCTCAAGGCGCTGGGTACGCTATTGTATTGGGCCTA GGGGCCGTATTTGCAGGAATGATGGTTTTGACCACTTATTTACTGAAACGTTATCAAAAG GAAATCATCACAGCAGAAGAATTCACCACCGCCGGTAGATCTGTAAAAACCGGCTTAGTG GCTGCAGCCGTGGTTTCTAGTTGGATCTGGTGTTCTACATTGTTAACGTCGTCAACAAAG GAATATGCAGACGGTATATTTGGCGGTTATGCGTACGCTGCTGGCGCATGCTTCCAAATT ATTGCATTCGCAATTTTGGCAATTAAAACCAAGCAAATGGCTCCCAATGCGCACACATAT TTAGAATTAGTGAGAACAAGATATGGTAAGATCGGCCATGGTTGCTACTTGTTTTATGCC ATCGCGACGAATATTTTAGTCACTTCAATGCTTTTAACTTCAGGTTCTGCTGTCTTTAGT GATTTAACCGGGATGAACACTATCGCATCATGTTTTTTACTGCCTGTGGGTGTTGTTGTT TATACTCTATTTGGTGGGATTAAAGCAACTTTCTTAACGGACTATATGCACACATGTGTC ATTATCATCATTGTCCTCGTATTTGCCTTTAAAGTTTATGCGACTAGTGATGTTTTAGGC TCACCGGGAAAAGTTTATGACTTAGTTCGTGAAGCCGCCAAGAGGCATCCAGTAGACGGT AACTATCAGGGTGAATATATGACCATGACATCCAAATCCGCTGGTATTTTATTAATTATT AACCTGATTGGAAATTTCGGCACCGTTTTCCTTGATAATGGTTATTGGAATAAAGCGATT TCTGCTAGTCCCGCAGCGAGTTTGAAAGCATATGCCATCGGTGGGTTAGCATGGTTTGCA GTACCTTCTTTGATTTCATTGACCATGGGATTAGCATGTCTTGCGGTGGAAACGTCTCCG AACTTCCCCACCTATCCTGATCCACTTACTTCGTTCCAGGCAAATTCTGGGTTAGTCTTG CCGGCAGCTGCAATTGCTATCATGGGTAAGGGGGGTGCTGTGGCATCGCTGCTAATGATT TTCATGGCCGTCACATCTGCTATGTCTGCTGAACTAATTGCCGTTTCATCTGTTTTCACT TACGATATCTATAGAGAATATATTGATCCTCGTGCAAGCGGTAAGAAATTGATTTACACA TCACACGTTGCTTGTATCTTTTTTGGTCTTGCCATGAGTGGATTTTCGGTTGGTTTATAC TATGGTGGTATTTCTATGGGTTATATCTATGAAATGATGGGTATAATTATTAGTAGTGCA GTATTACCTGTCGTTTTGACCTTATGTTCCAAAGACATGAATTTGGTGGCCGCTGTAGTG TCGCCTATTTTGGGCACAGGACTGGCTATAATGTCATGGCTTGTCTGTACCAAATCCCTT TATAAAGAATTGACCGTGGATACTACGTTCATGGATTATCCAATGTTAACAGGTAACTTG GTGGCTTTGCTATCACCAGCCATTTTTATTCCTATTTTAACGTATGTGTTTAAGCCACAA AATTTTGACTGGGAGAAAATGAAAGATATTACTAGAGTTGACGAAACTGCAGAGTTAGTT CAGGCTGACCCTGATATCCAGCTTTACGATGCTGAAGCTAACGATAAGGAACAAGAAGAA GAAACAAATTCTCTGGTCTCAGATAGTGAAAAAAACGATGTTAGAGTAAATAATGAAAAA TTGATTGAGCCTAACCTTGGTGTTGTAATAAGTAATGCCATTTTTCAAGAAGATGACACA CAGTTACAAAATGAATTAGACGAAGAACAAAGAGAACTAGCACGTGGTTTAAAAATTGCA TACTTCCTATGTGTTTTTTTCGCTTTGGCATTTTTGGTAGTTTGGCCCATGCCCATGTAT GGTTCCAAATATATCTTCAGTAAAAAATTCTTTACCGGTTGGGTTGTTGTGATGATCATC TGGCTTTTTTTCAGTGCGTTTGCCGTTTGTATTTATCCACTCTGGGAAGGTAGGCATGGT ATATATACCACTTTGCGAGGCCTTTACTGGGATCTATCTGGTCAAACTTATAAATTAAGG GAATGGCAAAATTCGAACCCACAAGATCTGCATGTAGTAACAAGCCAAATTAGTGCGAGA GCACATAGACAATCATCACATTTCGGACAAGTTGATGAAATAATTTAG
Protein Properties
Pfam Domain Function
Protein Residues735
Protein Molecular Weight80616.10156
Protein Theoretical pI5.36
Signalling Regions
  • None
Transmembrane Regions
  • 15-35
  • 86-106
  • 131-151
  • 167-187
  • 190-210
  • 254-274
  • 296-316
  • 344-364
  • 404-424
  • 426-446
  • 455-475
  • 497-517
  • 619-639
  • 651-671
Protein Sequence>Urea active transporter MGEFKPPLPQGAGYAIVLGLGAVFAGMMVLTTYLLKRYQKEIITAEEFTTAGRSVKTGLV AAAVVSSWIWCSTLLTSSTKEYADGIFGGYAYAAGACFQIIAFAILAIKTKQMAPNAHTY LELVRTRYGKIGHGCYLFYAIATNILVTSMLLTSGSAVFSDLTGMNTIASCFLLPVGVVV YTLFGGIKATFLTDYMHTCVIIIIVLVFAFKVYATSDVLGSPGKVYDLVREAAKRHPVDG NYQGEYMTMTSKSAGILLIINLIGNFGTVFLDNGYWNKAISASPAASLKAYAIGGLAWFA VPSLISLTMGLACLAVETSPNFPTYPDPLTSFQANSGLVLPAAAIAIMGKGGAVASLLMI FMAVTSAMSAELIAVSSVFTYDIYREYIDPRASGKKLIYTSHVACIFFGLAMSGFSVGLY YGGISMGYIYEMMGIIISSAVLPVVLTLCSKDMNLVAAVVSPILGTGLAIMSWLVCTKSL YKELTVDTTFMDYPMLTGNLVALLSPAIFIPILTYVFKPQNFDWEKMKDITRVDETAELV QADPDIQLYDAEANDKEQEEETNSLVSDSEKNDVRVNNEKLIEPNLGVVISNAIFQEDDT QLQNELDEEQRELARGLKIAYFLCVFFALAFLVVWPMPMYGSKYIFSKKFFTGWVVVMII WLFFSAFAVCIYPLWEGRHGIYTTLRGLYWDLSGQTYKLREWQNSNPQDLHVVTSQISAR AHRQSSHFGQVDEII
References
External Links
ResourceLink
Saccharomyces Genome Database DUR3
Uniprot IDP33413
Uniprot NameDUR3_YEAST
GenBank Gene IDAY693170
Genebank Protein ID51013791
General Reference
  • ElBerry, H. M., Majumdar, M. L., Cunningham, T. S., Sumrada, R. A., Cooper, T. G. (1993). "Regulation of the urea active transporter gene (DUR3) in Saccharomyces cerevisiae." J Bacteriol 175:4688-4698.8335627
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258