You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameEthanolamine-phosphate cytidylyltransferase
Synonyms
  • CTP:phosphoethanolamine cytidylyltransferase
  • Phosphorylethanolamine transferase
Gene NameMUQ1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCTP + ethanolamine phosphate = diphosphate + CDP-ethanolamine
Cellular LocationNot Available
SMPDB Pathways
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
O-Phosphoethanolamine + hydron + Cytidine triphosphateCDP-Ethanolamine + Pyrophosphate
KEGG Reactions
hydron + Cytidine triphosphate + O-PhosphoethanolaminePyrophosphate + CDP-Ethanolamine
Metabolites
YMDB IDNameView
YMDB00125O-PhosphoethanolamineShow
YMDB00219PyrophosphateShow
YMDB00279Cytidine triphosphateShow
YMDB00389CDP-EthanolamineShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
Process
metabolic process
biosynthetic process
Gene Properties
Chromosome LocationNot Available
LocusYGR007W
Gene Sequence>972 bp ATGACGGTAAACTTAGATCCGGATAAAGTTTGGATAGACGGCTGCTTTGATTTCACACAT CATGGGCATGCGGGAGCCATTTTGCAGGCTCGTCGAACAGTTTCAAAAGAAAATGGTAAA CTATTCTGTGGTGTGCATACCGATGAAGATATTCAGCATAACAAAGGAACACCAGTAATG AACTCTTCAGAAAGATATGAGCATACTAGATCAAATAGGTGGTGTTCGGAAGTGGTTGAA GCGGCGCCATATGTTACAGATCCCAATTGGATGGATAAATATCAGTGCCAATATGTTGTT CATGGTGATGATATCACCATAGATGCTAATGGAGAAGACTGCTATAAGTTGGTGAAAGAG ATGGGGCGCTTCAAGGTAGTTAAAAGAACATATGGCGTAAGTACTACCGAGATTATACAT AGAATATTGACGAAAAAATCTTTGCCACCGACTCATCCTGATTATTATCCCACCACCCAG GAATTGAGTTTCTATTCTGTCGCCCAAGATGCCGTTTCAAAACATTGTTATGTCTTTCAG AGGGATTTGGACAATGTCTTGGTCAATGGTGGATACAAATTCGATGCAGAAGATTGTGTT TATGTTGACGGGGATTTTGACTTATTCCATATGGGGGATATTGATCAGTTAAGAAAGCTG AAAATGGATCTTCACCCCGATAAGAAATTGATTGTTGGTATTACCACAAGCGATTACTCG AGTACCATTATGACGATGAAGGAACGCGTCTTGAGCGTTTTAAGTTGTAAATATGTTGAT GCCGTTATTATCGATGCTGACGCCACCTCAATGTCTCAGTATAACTGCGAGAAGTATCAT ATTGGCACGGCTGTCCTCACTGCTGCCGGAAAATTCAGTGAATACTTGACTAAAGAGCTT ATTGTGAAGAGGGTGGAATCGCAAAGGGAGGTTTACATTGCGAGGAACCAAAAAAAGGGA ATGTCCATATAA
Protein Properties
Pfam Domain Function
Protein Residues323
Protein Molecular Weight36862.60156
Protein Theoretical pI6.44
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ethanolamine-phosphate cytidylyltransferase MTVNLDPDKVWIDGCFDFTHHGHAGAILQARRTVSKENGKLFCGVHTDEDIQHNKGTPVM NSSERYEHTRSNRWCSEVVEAAPYVTDPNWMDKYQCQYVVHGDDITIDANGEDCYKLVKE MGRFKVVKRTYGVSTTEIIHRILTKKSLPPTHPDYYPTTQELSFYSVAQDAVSKHCYVFQ RDLDNVLVNGGYKFDAEDCVYVDGDFDLFHMGDIDQLRKLKMDLHPDKKLIVGITTSDYS STIMTMKERVLSVLSCKYVDAVIIDADATSMSQYNCEKYHIGTAVLTAAGKFSEYLTKEL IVKRVESQREVYIARNQKKGMSI
References
External Links
ResourceLink
Saccharomyces Genome Database MUQ1
Uniprot IDP33412
Uniprot NameECT1_YEAST
GenBank Gene IDAY557830
Genebank Protein ID45269551
General Reference
  • Horowitz, D. S., Abelson, J. (1993). "A U5 small nuclear ribonucleoprotein particle protein involved only in the second step of pre-mRNA splicing in Saccharomyces cerevisiae." Mol Cell Biol 13:2959-2970.8474454
  • Min-Seok, R., Kawamata, Y., Nakamura, H., Ohta, A., Takagi, M. (1996). "Isolation and characterization of ECT1 gene encoding CTP: phosphoethanolamine cytidylyltransferase of Saccharomyces cerevisiae." J Biochem 120:1040-1047.8982874
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106