You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoglucomutase-1
Synonyms
  • PGM 1
  • Glucose phosphomutase 1
Gene NamePGM1
Enzyme Class
Biological Properties
General FunctionInvolved in intramolecular transferase activity, phosphotransferases
Specific FunctionThis enzyme participates in both the breakdown and synthesis of glucose. Can also act on mannose
Cellular LocationCytoplasm
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
Leloir PathwayPW002397 ThumbThumb?image type=greyscaleThumb?image type=simple
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Galactose metabolismec00052 Map00052
Glycolysis / Gluconeogenesisec00010 Map00010
Pentose phosphate pathwayec00030 Map00030
Purine metabolismec00230 Map00230
SMPDB Reactions
Glucose 1-phosphateGlucose 6-phosphate
Beta-D-Glucose 6-phosphateGlucose 1-phosphate
KEGG Reactions
Glucose 1-phosphatealdehydo-D-glucose 6-phosphate
Ribose 1-phosphatealpha-D-ribose 5-phosphate
Metabolites
YMDB IDNameView
YMDB00061Ribose 1-phosphateShow
YMDB00288Glucose 1-phosphateShow
YMDB00311Beta-D-Glucose 6-phosphateShow
YMDB00582aldehydo-D-glucose 6-phosphateShow
YMDB00650alpha-D-ribose 5-phosphateShow
YMDB00947Glucose 6-phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
ion binding
cation binding
metal ion binding
magnesium ion binding
isomerase activity
intramolecular transferase activity
intramolecular transferase activity, phosphotransferases
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL127W
Gene Sequence>1713 bp ATGTCACTTCTAATAGATTCTGTACCAACAGTTGCTTATAAGGACCAAAAACCGGGTACT TCAGGTTTACGTAAGAAGACCAAGGTTTTCATGGATGAGCCTCATTATACTGAGAACTTC ATTCAAGCAACAATGCAATCTATCCCTAATGGCTCAGAGGGAACCACTTTAGTTGTTGGA GGAGATGGTCGTTTCTACAACGATGTTATCATGAACAAGATTGCCGCAGTAGGTGCTGCA AACGGTGTCAGAAAGTTAGTCATTGGTCAAGGCGGTTTACTTTCAACACCAGCTGCTTCT CATATAATTAGAACATACGAGGAAAAGTGTACCGGTGGTGGTATCATATTAACTGCCTCA CACAACCCAGGCGGTCCAGAGAATGATTTAGGTATCAAGTATAATTTACCTAATGGTGGG CCAGCTCCAGAGAGTGTCACTAACGCTATCTGGGAAGCGTCTAAAAAATTAACTCACTAT AAAATTATAAAGAACTTCCCCAAGTTGAATTTGAACAAGCTTGGTAAAAACCAAAAATAT GGCCCATTGTTAGTGGACATAATTGATCCTGCCAAAGCATACGTTCAATTTCTGAAGGAA ATTTTTGATTTTGACTTAATTAAAAGCTTCTTAGCGAAACAGCGCAAAGACAAAGGGTGG AAGTTGTTGTTTGACTCCTTAAATGGTATTACAGGACCATATGGTAAGGCTATATTTGTT GATGAATTTGGTTTACCGGCAGAGGAAGTTCTTCAAAATTGGCACCCTTTACCTGATTTC GGCGGTTTACATCCCGATCCGAATCTAACCTATGCACGAACTCTTGTTGACAGGGTTGAC CGCGAAAAAATTGCCTTTGGAGCAGCCTCCGATGGTGATGGTGATAGGAATATGATTTAC GGTTATGGCCCTGCTTTCGTTTCGCCAGGTGATTCTGTTGCCATTATTGCCGAATATGCA CCCGAAATTCCATACTTCGCCAAACAAGGTATTTATGGCTTGGCACGTTCATTTCCTACA TCCTCAGCCATTGATCGTGTTGCAGCAAAAAAGGGATTAAGATGTTACGAAGTTCCAACC GGCTGGAAATTCTTCTGTGCCTTATTTGATGCTAAAAAGCTATCAATCTGTGGTGAAGAA TCCTTCGGTACAGGTTCCAATCATATCAGAGAAAAGGACGGTCTATGGGCCATTATTGCT TGGTTAAATATCTTGGCTATCTACCATAGGCGTAACCCTGAAAAGGAAGCTTCGATCAAA ACTATTCAGGACGAATTTTGGAACGAGTATGGCCGTACTTTCTTCACAAGATACGATTAC GAACATATCGAATGCGAGCAGGCCGAAAAAGTTGTAGCTCTTTTGAGTGAATTTGTATCA AGGCCAAACGTTTGTGGCTCCCACTTCCCAGCTGATGAGTCTTTAACCGTTATCGATTGT GGTGATTTTTCGTATAGAGATCTAGATGGCTCCATCTCTGAAAATCAAGGCCTTTTCGTA AAGTTTTCGAATGGGACTAAATTTGTTTTGAGGTTATCCGGCACAGGCAGTTCTGGTGCA ACAATAAGATTATACGTAGAAAAGTATACTGATAAAAAGGAGAACTATGGCCAAACAGCT GACGTCTTCTTGAAACCCGTCATCAACTCCATTGTAAAATTCTTAAGATTTAAAGAAATT TTAGGAACAGACGAACCAACAGTCCGCACATAG
Protein Properties
Pfam Domain Function
Protein Residues570
Protein Molecular Weight63111.30078
Protein Theoretical pI7.27
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoglucomutase-1 MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYKIIKNFPKLNLNKLGKNQKY GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIIAWLNILAIYHRRNPEKEASIK TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDC GDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTA DVFLKPVINSIVKFLRFKEILGTDEPTVRT
References
External Links
ResourceLink
Saccharomyces Genome Database PGM1
Uniprot IDP33401
Uniprot NamePGM1_YEAST
GenBank Gene IDX72016
Genebank Protein ID397624
General Reference
  • Boles, E., Liebetrau, W., Hofmann, M., Zimmermann, F. K. (1994). "A family of hexosephosphate mutases in Saccharomyces cerevisiae." Eur J Biochem 220:83-96.8119301
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956