You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameBeta-glucan synthesis-associated protein SKN1
SynonymsNot Available
Gene NameSKN1
Enzyme ClassNot Available
Biological Properties
General FunctionCarbohydrate transport and metabolism
Specific FunctionRequired for synthesis of the major beta-glucans of the yeast cell wall
Cellular LocationMembrane; Single-pass type II membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Uridine diphosphate glucoseUridine 5'-diphosphate + hydron + (1->6)-beta-D-glucan
Metabolites
YMDB IDNameView
YMDB00307Uridine 5'-diphosphateShow
YMDB00415UDP-D-glucoseShow
YMDB00862hydronShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 7
LocusYGR143W
Gene Sequence>2316 bp ATGTCTGTGCGAAACCTCACCAATAATCGTCATTCCAACAGCGAAAATAGTGTTTCCGGA AGCGAAAACTCCTTTTATTCCTCGAATGAGCAATCAAGACAAAGCTCATCATTAGAACCT GCAGATGGTCAGAACGTTAGGGTGAGCGGTAATCCTTTCCTTGGAAGTGAAGAATTTGAC GAAGATTATAATTCACCCAGTGGAGACGATGAGCGGCGTGGGGCAAATGAATATTCCAGT TCTTCATCCATAAATTATAATAACGATCCTAACAGCGATACTTCTCTTCTGGCTAATGAA AAGAACTCACCCGAGAGAAATGGTCAAAGAATGTCAGACTATAAGGGCTATTATGCTAAG ACTAACCTAACTTCTGCTAATAACTTAAACAATCATAATAACAATAATTATAAGAACATT ATAAGCAGTAGTAACGATAATAGTTTTGCATCACATTTACAGCCGCCGGACAGAAACTTA CCGTCTCATCCTTCTTCAAATAATATGAGTAGCTTTTCTAACAACAGCTTAATTAAGTCT CCACCACCTTTTGACAGATATCCGCTAGTAGGAACGAGGCATATTTCAGCGGCTCAATCT CAGTCGCAGAACCTTATAAATGAAAAGAAAAGAGCGAATATGACTGGCTCATCTTCTTCT GCTCACGACTCTTCATTATCATCCACCAACTTATACATGGGCGAACAGGATTTTTCGCCC TTTGGCGGTTATCCAGCTTCCTTCTTTCCGTTAACGTTGGACGAAAAGGAAGACGATGAC TACATTCATAATCCAAATGTCGAGGAAGAAGCAAAGTTAGATAGAAGGAGGTTCGTTGAC GACTTCAAACACATGGATAGAAGATCTTTCTTGGGGCTTCTGGGTATTCTATTTTTATTT ATGGCTGGTATATTTATTTTCATTGTATTACCTGCAATTACATTTTCCGGGGTAGTTTAT CATCATGAACATGTTCATGCGGCAAATTCAGCAGGATCGTCGTCTTCTAATACTACATCC AAGTCATTGACTGAATATCAATATCCTCAACTTGCGGCTATAAGGACAACTTTAGTTGAT CCAGACACACCTGACAGTGCGAAGACAAGAGTAGCGAAAGATGGATCTAAATGGCAGCTG GTGTTTTCCGATGAATTTAATGCTGAAGGTAGGACCTTTTACGATGGCGATGACCAGTTT TGGACAGCTCCTGACATCCACTACGACGCTACGAAAGATCTTGAATGGTACTCACCAGAT GCCGTTACAACTACAAATGGTACCTTGACGTTGAGAATGGATGCATTCAGAAACCATGAC CTTTATTACAGATCTGGTATGGTACAGAGCTGGAACAAACTCTGCTTTACAGAAGGTGCG TTAGAAGTTTCCGCGAACCTCCCTAATTATGGTCGAGTTACAGGATTATGGCCTGGTATG TGGACCATGGGGAACTTGGGCAGACCAGGTTATTTGGCGAGTACTCAAGGTGTTTGGCCT TATTCATATGAAGCATGTGACGCTGGTATAACACCAAACCAAAGTTCCCCAGATGGTATT TCTTACTTGCCGGGACAAAAGTTGAGTGTTTGTACTTGTGATAATGAGGATCATCCAAAT CAGGGAGTTGGAAGAGGCGCACCGGAAATAGATATTTTAGAAGGTGAAGCTGATACAATT TTGGGTGTTGGTGTTGCGTCACAATCTCTACAAATTGCTCCATTTGATATATGGTACATG CCCGATTATGACTTCATCGAAGTTTATAATTTCACCACAACAACTATGAATACTTACGCT GGTGGGCCTTTTCAACAAGCTGTCTCAGCAATATCCACTTTAAATGTAACATGGTATGAA TTTGGGGAGGAAGCAGGTTATTTTCAAAAGTATGCCATTGAATATCTCAATGATGACGAC AACGGATATATTCGTTGGTTTGTGGGAGAGAACCCTACTTTCACACTATATGCTACTTCT TTACATCCTAGTGGTAATATTGACTGGAGGAGAATAAGTAAGGAGCCAATGTCAGCGATT TTAAACTTAGGTATTTCCAACAACTGGGCCTATATCGACTGGCAATATATATTTTTCCCG GTGACAATGTCAATAGATTACGTCCGATTATACCAGCCGAAGGGTTCTACGTCCATTACT TGTGATCCTGAGGACTACCCGACATATGATTATATCCAAAGCCATCTAAATGCATATTAT AACGCCAATTTAACTGATTGGGAACAGGCTGGATATACTTTCCCAAAAAATATTCTAACA GGAGGTTGTAGTAGTTCAAAATTCTCATTATCCTGA
Protein Properties
Pfam Domain Function
Protein Residues771
Protein Molecular Weight86240.39844
Protein Theoretical pI4.45
Signalling Regions
  • None
Transmembrane Regions
  • 290-310
Protein Sequence>Beta-glucan synthesis-associated protein SKN1 MSVRNLTNNRHSNSENSVSGSENSFYSSNEQSRQSSSLEPADGQNVRVSGNPFLGSEEFD EDYNSPSGDDERRGANEYSSSSSINYNNDPNSDTSLLANEKNSPERNGQRMSDYKGYYAK TNLTSANNLNNHNNNNYKNIISSSNDNSFASHLQPPDRNLPSHPSSNNMSSFSNNSLIKS PPPFDRYPLVGTRHISAAQSQSQNLINEKKRANMTGSSSSAHDSSLSSTNLYMGEQDFSP FGGYPASFFPLTLDEKEDDDYIHNPNVEEEAKLDRRRFVDDFKHMDRRSFLGLLGILFLF MAGIFIFIVLPAITFSGVVYHHEHVHAANSAGSSSSNTTSKSLTEYQYPQLAAIRTTLVD PDTPDSAKTRVAKDGSKWQLVFSDEFNAEGRTFYDGDDQFWTAPDIHYDATKDLEWYSPD AVTTTNGTLTLRMDAFRNHDLYYRSGMVQSWNKLCFTEGALEVSANLPNYGRVTGLWPGM WTMGNLGRPGYLASTQGVWPYSYEACDAGITPNQSSPDGISYLPGQKLSVCTCDNEDHPN QGVGRGAPEIDILEGEADTILGVGVASQSLQIAPFDIWYMPDYDFIEVYNFTTTTMNTYA GGPFQQAVSAISTLNVTWYEFGEEAGYFQKYAIEYLNDDDNGYIRWFVGENPTFTLYATS LHPSGNIDWRRISKEPMSAILNLGISNNWAYIDWQYIFFPVTMSIDYVRLYQPKGSTSIT CDPEDYPTYDYIQSHLNAYYNANLTDWEQAGYTFPKNILTGGCSSSKFSLS
References
External Links
ResourceLink
Saccharomyces Genome Database SKN1
Uniprot IDP33336
Uniprot NameSKN1_YEAST
GenBank Gene IDL18859
Genebank Protein ID311157
General Reference
  • Roemer, T., Delaney, S., Bussey, H. (1993). "SKN1 and KRE6 define a pair of functional homologs encoding putative membrane proteins involved in beta-glucan synthesis." Mol Cell Biol 13:4039-4048.8321211
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Roemer, T., Paravicini, G., Payton, M. A., Bussey, H. (1994). "Characterization of the yeast (1-->6)-beta-glucan biosynthetic components, Kre6p and Skn1p, and genetic interactions between the PKC1 pathway and extracellular matrix assembly." J Cell Biol 127:567-579.7929594
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956