You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable 1-acyl-sn-glycerol-3-phosphate acyltransferase
Synonyms
  • 1-AGP acyltransferase
  • 1-AGPAT
  • Lysophosphatidic acid acyltransferase
  • LPAAT
Gene NameSLC1
Enzyme Class
Biological Properties
General FunctionInvolved in acyltransferase activity
Specific FunctionMay be an acyltransferase with an altered substrate specificity that enables it to use a C-26-CoA in place of the C-16 or C-18-CoAs used by the wild-type protein
Cellular LocationMembrane; Single-pass membrane protein (Potential)
SMPDB Pathways
Cardiolipin Biosynthesis CL(10:0/10:0/14:0/26:1(11Z))PW003509 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/14:0/26:1(9Z))PW003510 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/14:0/28:0)PW003511 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/14:0/28:1(11Z))PW003512 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/14:0/28:1(9Z))PW003513 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerolipid metabolismec00561 Map00561
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
oleoyl-CoA + 1-oleyl-2-lyso-phosphatidateCoenzyme A + PA(18:1(9Z)/18:1(9Z))
PA(16:0/0:0) + Palmityl-CoACoenzyme A + PA(16:0/16:0)
PA(16:0/0:0) + Palmityl-CoADG(16:0/16:0/0:0) + Coenzyme A
PA(16:0/0:0) + Palmitic acidPA(16:0/16:0) + Coenzyme A
PA(16:0/0:0) + Palmityl-CoA Coenzyme A + PA(16:0/16:0)
KEGG Reactions
acyl-CoA + PA(18:1(9Z)/0:0)hydron + LPA(16:0/0:0) + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00069Palmitic acidShow
YMDB00301Palmityl-CoAShow
YMDB00539oleoyl-CoAShow
YMDB00862hydronShow
YMDB01127DG(16:0/16:0/0:0)Show
YMDB01160PA(16:0/0:0)Show
YMDB01161PA(16:0/16:0)Show
YMDB163021-oleyl-2-lyso-phosphatidateShow
GO Classification
Component
membrane
cell part
Function
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
O-acyltransferase activity
acylglycerol O-acyltransferase activity
1-acylglycerol-3-phosphate O-acyltransferase activity
catalytic activity
transferase activity
Process
organophosphate metabolic process
phospholipid metabolic process
phospholipid biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL052C
Gene Sequence>912 bp ATGAGTGTGATAGGTAGGTTCTTGTATTACTTGAGGTCCGTGTTGGTCGTACTGGCGCTT GCAGGCTGTGGCTTTTACGGTGTAATCGCCTCTATCCTTTGCACGTTAATCGGTAAGCAA CATTTGGCTCAGTGGATTACTGCGCGTTGTTTTTACCATGTCATGAAATTGATGCTTGGC CTTGACGTCAAGGTCGTTGGCGAGGAGAATTTGGCCAAGAAGCCATATATTATGATTGCC AATCACCAATCCACCTTGGATATCTTCATGTTAGGTAGGATTTTCCCCCCTGGTTGCACA GTTACTGCCAAGAAGTCTTTGAAATACGTCCCCTTTCTGGGTTGGTTCATGGCTTTGAGT GGTACATATTTCTTAGACAGATCTAAAAGGCAAGAAGCCATTGACACCTTGAATAAAGGT TTAGAAAATGTTAAGAAAAACAAGCGTGCTCTATGGGTTTTTCCTGAGGGTACCAGGTCT TACACGAGTGAGCTGACAATGTTGCCTTTCAAGAAGGGTGCTTTCCATTTGGCACAACAG GGTAAGATCCCCATTGTTCCAGTGGTTGTTTCCAATACCAGTACTTTAGTAAGTCCTAAA TATGGGGTCTTCAACAGAGGCTGTATGATTGTTAGAATTTTAAAACCTATTTCAACCGAG AACTTAACAAAGGACAAAATTGGTGAATTTGCTGAAAAAGTTAGAGATCAAATGGTTGAC ACTTTGAAGGAGATTGGCTACTCTCCCGCCATCAACGATACAACCCTCCCACCACAAGCT ATTGAGTATGCCGCTCTTCAACATGACAAGAAAGTGAACAAGAAAATCAAGAATGAGCCT GTGCCTTCTGTCAGCATTAGCAACGATGTCAATACCCATAACGAAGGTTCATCTGTAAAA AAGATGCATTAA
Protein Properties
Pfam Domain Function
Protein Residues303
Protein Molecular Weight33886.69922
Protein Theoretical pI10.15
Signalling Regions
  • None
Transmembrane Regions
  • 16-30
Protein Sequence>Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase MSVIGRFLYYLRSVLVVLALAGCGFYGVIASILCTLIGKQHLAQWITARCFYHVMKLMLG LDVKVVGEENLAKKPYIMIANHQSTLDIFMLGRIFPPGCTVTAKKSLKYVPFLGWFMALS GTYFLDRSKRQEAIDTLNKGLENVKKNKRALWVFPEGTRSYTSELTMLPFKKGAFHLAQQ GKIPIVPVVVSNTSTLVSPKYGVFNRGCMIVRILKPISTENLTKDKIGEFAEKVRDQMVD TLKEIGYSPAINDTTLPPQAIEYAALQHDKKVNKKIKNEPVPSVSISNDVNTHNEGSSVK KMH
References
External Links
ResourceLink
Saccharomyces Genome Database SLC1
Uniprot IDP33333
Uniprot NamePLSC_YEAST
GenBank Gene IDL13282
Genebank Protein ID349187
General Reference
  • Nagiec, M. M., Wells, G. B., Lester, R. L., Dickson, R. C. (1993). "A suppressor gene that enables Saccharomyces cerevisiae to grow without making sphingolipids encodes a protein that resembles an Escherichia coli fatty acyltransferase." J Biol Chem 268:22156-22163.8408076
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867