You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameTransketolase 2
Synonyms
  • TK 2
Gene NameTKL2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionSedoheptulose 7-phosphate + D-glyceraldehyde 3-phosphate = D-ribose 5-phosphate + D-xylulose 5-phosphate
Cellular LocationNot Available
SMPDB Pathways
RiboneogenesisPW002511 ThumbThumb?image type=greyscaleThumb?image type=simple
xylitol degradationPW002433 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pentose phosphate pathwayec00030 Map00030
SMPDB Reactions
Xylulose 5-phosphate + D-Ribose 5-phosphate → L-Glyceraldehyde 3-phosphate + D-Sedoheptulose 7-phosphate
Xylulose 5-phosphate + D-Ribose 5-phosphateD-Glyceraldehyde 3-phosphate + D-Sedoheptulose 7-phosphate
D-Erythrose 4-phosphate + Xylulose 5-phosphateβ-D-fructofuranose 6-phosphate + D-Glyceraldehyde 3-phosphate
Beta-D-Fructose 6-phosphate + D-Glyceraldehyde 3-phosphateXylulose 5-phosphate + D-Erythrose 4-phosphate
D-Sedoheptulose 7-phosphate + D-Glyceraldehyde 3-phosphateXylulose 5-phosphate + D-Ribose 5-phosphate
KEGG Reactions
alpha-D-ribose 5-phosphate + Xylulose 5-phosphateD-Glyceraldehyde 3-phosphate + D-Sedoheptulose 7-phosphate
D-Erythrose 4-phosphate + Xylulose 5-phosphateD-Glyceraldehyde 3-phosphate + Fructose 6-phosphate
Metabolites
YMDB IDNameView
YMDB00078Fructose 6-phosphateShow
YMDB00115D-Glyceraldehyde 3-phosphateShow
YMDB00119D-Ribose 5-phosphateShow
YMDB00196D-Sedoheptulose 7-phosphateShow
YMDB00223D-Erythrose 4-phosphateShow
YMDB00362Xylulose 5-phosphateShow
YMDB00650alpha-D-ribose 5-phosphateShow
YMDB00752Sedoheptulose 7-phosphateShow
YMDB16176Beta-D-Fructose 6-phosphateShow
YMDB16262β-D-fructofuranose 6-phosphateShow
GO Classification
Component
Not Available
Function
transferase activity, transferring aldehyde or ketonic groups
transketolase activity
catalytic activity
transferase activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR117C
Gene Sequence>2046 bp ATGGCACAGTTCTCCGACATTGATAAACTTGCGGTTTCCACTTTAAGATTACTTTCCGTT GACCAGGTGGAAAGCGCACAATCTGGCCACCCAGGTGCACCACTAGGATTGGCACCAGTT GCCCATGTAATTTTCAAGCAACTGCGCTGTAACCCTAACAATGAACATTGGATCAATAGA GACAGGTTTGTTCTGTCGAACGGTCACTCATGCGCTCTTCTGTACTCAATGCTCCATCTA TTAGGATACGATTACTCTATCGAGGACTTGAGACAATTTAGACAAGTAAACTCAAGGACA CCGGGTCATCCAGAATTCCACTCAGCGGGAGTGGAAATCACTTCCGGTCCGCTAGGCCAG GGTATCTCAAATGCTGTTGGTATGGCAATAGCGCAGGCCAACTTTGCCGCCACTTATAAC GAGGATGGCTTTCCCATTTCCGACTCATATACGTTTGCTATTGTAGGGGATGGTTGCTTA CAAGAGGGTGTTTCTTCGGAGACCTCTTCCTTAGCGGGACATCTGCAATTGGGTAACTTG ATTACGTTTTATGACAGTAATAGCATTTCCATTGACGGTAAAACCTCGTACTCGTTCGAC GAAGATGTTTTGAAGCGATACGAGGCATATGGTTGGGAAGTCATGGAAGTCGATAAAGGA GACGACGATATGGAATCCATTTCTAGCGCTTTGGAAAAGGCAAAACTATCGAAGGACAAG CCAACCATAATCAAGGTAACTACTACAATTGGATTTGGGTCCCTACAACAGGGTACTGCT GGTGTTCATGGGTCCGCTTTGAAGGCAGATGATGTTAAACAGTTGAAGAAGAGGTGGGGG TTTGACCCAAATAAATCATTTGTAGTACCTCAAGAGGTGTACGATTATTATAAGAAGACT GTTGTGGAACCCGGTCAAAAACTTAATGAGGAATGGGATAGGATGTTTGAAGAATACAAA ACCAAATTTCCCGAGAAGGGTAAAGAATTGCAAAGAAGATTGAATGGTGAGTTACCGGAA GGTTGGGAAAAGCATTTACCGAAGTTTACTCCGGACGACGATGCTCTGGCAACAAGAAAG ACATCCCAGCAGGTGCTGACGAACATGGTCCAAGTTTTGCCTGAATTGATCGGTGGTTCT GCCGATTTGACACCTTCGAATCTGACAAGGTGGGAAGGCGCGGTAGATTTCCAACCTCCC ATTACCCAACTAGGTAACTATGCAGGAAGGTACATTAGATACGGTGTGAGGGAACACGGA ATGGGTGCCATTATGAACGGTATCTCTGCCTTTGGTGCAAACTACAAGCCTTACGGTGGT ACCTTTTTGAACTTCGTCTCTTATGCTGCAGGAGCCGTTAGGTTAGCCGCCTTGTCTGGT AATCCAGTCATTTGGGTTGCAACACATGACTCTATCGGGCTTGGTGAGGATGGTCCAACG CACCAACCTATTGAAACTCTGGCTCACTTGAGGGCTATTCCAAACATGCATGTATGGAGA CCTGCTGATGGTAACGAAACTTCTGCTGCGTATTATTCTGCTATCAAATCTGGTCGAACA CCATCTGTTGTGGCTTTATCACGACAGAATCTTCCTCAATTGGAGCATTCCTCTTTTGAA AAAGCCTTGAAGGGTGGCTATGTGATCCATGACGTGGAGAATCCTGATATTATCCTGGTG TCAACAGGATCAGAAGTCTCCATTTCTATAGATGCAGCCAAAAAATTGTACGATACTAAA AAAATCAAAGCAAGAGTTGTTTCCCTGCCAGACTTTTATACTTTTGACAGGCAAAGTGAA GAATACAGATTCTCTGTTCTACCAGACGGTGTTCCGATCATGTCCTTTGAAGTATTGGCT ACTTCAAGCTGGGGTAAGTATGCTCATCAATCGTTCGGACTCGACGAATTTGGTCGTTCA GGCAAGGGGCCTGAAATTTACAAATTGTTCGATTTCACAGCGGACGGTGTTGCGTCAAGG GCTGAAAAGACAATCAATTACTACAAAGGAAAGCAGTTGCTTTCTCCTATGGGAAGAGCT TTCTAA
Protein Properties
Pfam Domain Function
Protein Residues681
Protein Molecular Weight75028.79688
Protein Theoretical pI6.05
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Transketolase 2 MAQFSDIDKLAVSTLRLLSVDQVESAQSGHPGAPLGLAPVAHVIFKQLRCNPNNEHWINR DRFVLSNGHSCALLYSMLHLLGYDYSIEDLRQFRQVNSRTPGHPEFHSAGVEITSGPLGQ GISNAVGMAIAQANFAATYNEDGFPISDSYTFAIVGDGCLQEGVSSETSSLAGHLQLGNL ITFYDSNSISIDGKTSYSFDEDVLKRYEAYGWEVMEVDKGDDDMESISSALEKAKLSKDK PTIIKVTTTIGFGSLQQGTAGVHGSALKADDVKQLKKRWGFDPNKSFVVPQEVYDYYKKT VVEPGQKLNEEWDRMFEEYKTKFPEKGKELQRRLNGELPEGWEKHLPKFTPDDDALATRK TSQQVLTNMVQVLPELIGGSADLTPSNLTRWEGAVDFQPPITQLGNYAGRYIRYGVREHG MGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLAALSGNPVIWVATHDSIGLGEDGPT HQPIETLAHLRAIPNMHVWRPADGNETSAAYYSAIKSGRTPSVVALSRQNLPQLEHSSFE KALKGGYVIHDVENPDIILVSTGSEVSISIDAAKKLYDTKKIKARVVSLPDFYTFDRQSE EYRFSVLPDGVPIMSFEVLATSSWGKYAHQSFGLDEFGRSGKGPEIYKLFDFTADGVASR AEKTINYYKGKQLLSPMGRAF
References
External Links
ResourceLink
Saccharomyces Genome Database TKL2
Uniprot IDP33315
Uniprot NameTKT2_YEAST
GenBank Gene IDX73532
Genebank Protein ID313262
General Reference
  • Schaaff-Gerstenschlager, I., Mannhaupt, G., Vetter, I., Zimmermann, F. K., Feldmann, H. (1993). "TKL2, a second transketolase gene of Saccharomyces cerevisiae. Cloning, sequence and deletion analysis of the gene." Eur J Biochem 217:487-492.7916691
  • Mannhaupt, G., Stucka, R., Ehnle, S., Vetter, I., Feldmann, H. (1994). "Analysis of a 70 kb region on the right arm of yeast chromosome II." Yeast 10:1363-1381.7900426
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106