You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSuccinate/fumarate mitochondrial transporter
Synonyms
  • Regulator of acetyl-CoA synthase activity
Gene NameSFC1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in binding
Specific FunctionTransports cytoplasmic succinate, derived from isocitrate by the action of isocitrate lyase in the cytosol, into the mitochondrial matrix in exchange for fumarate
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00101Fumaric acidShow
YMDB00338Succinic acidShow
GO Classification
Component
organelle membrane
organelle inner membrane
mitochondrial inner membrane
cell part
membrane
Function
binding
transporter activity
Process
establishment of localization
transport
transmembrane transport
Gene Properties
Chromosome Locationchromosome 10
LocusYJR095W
Gene Sequence>969 bp ATGTCTCAAAAAAAGAAGGCTTCCCATCCAGCCATCAATCTCATGGCTGGCGGCACAGCA GGTTTATTTGAAGCATTGTGTTGTCATCCTTTAGATACAATTAAGGTGAGAATGCAAATA TACAGACGGGTAGCTGGTATTGAACATGTTAAACCCCCAGGATTTATTAAAACTGGGCGT ACCATTTATCAAAAAGAAGGTTTCTTGGCTCTGTATAAAGGTCTAGGTGCTGTGGTCATC GGTATTATACCTAAGATGGCAATCCGTTTCTCGTCTTATGAATTCTATAGAACCTTATTG GTTAACAAGGAATCAGGAATTGTGTCTACCGGTAATACTTTTGTTGCTGGTGTTGGGGCT GGTATCACCGAAGCTGTTCTTGTCGTGAACCCGATGGAAGTTGTAAAGATTAGGTTACAA GCTCAGCATTTAACTCCGAGTGAGCCAAATGCTGGTCCTAAATATAACAACGCCATTCAT GCAGCCTACACTATTGTCAAAGAAGAAGGTGTTTCTGCCTTATATAGAGGCGTTTCCTTA ACTGCGGCAAGGCAAGCAACTAATCAGGGTGCTAACTTCACAGTTTATTCTAAACTGAAG GAGTTTTTGCAGAATTACCATCAGATGGATGTCCTACCTTCATGGGAAACTTCTTGCATA GGTTTGATTTCGGGTGCTATTGGGCCGTTTTCCAACGCTCCATTGGATACTATAAAGACA AGGCTGCAAAAGGATAAGTCCATCTCATTGGAAAAACAGTCCGGTATGAAGAAAATCATA ACCATTGGTGCTCAACTACTGAAAGAAGAAGGTTTTAGAGCTTTGTACAAGGGTATTACC CCAAGAGTGATGAGGGTGGCTCCAGGTCAGGCTGTCACCTTTACCGTTTATGAATATGTA AGGGAGCATTTAGAAAATTTGGGTATATTCAAGAAGAATGACACACCAAAGCCAAAGCCA TTAAAGTAG
Protein Properties
Pfam Domain Function
Protein Residues322
Protein Molecular Weight35340.10156
Protein Theoretical pI10.31
Signalling Regions
  • None
Transmembrane Regions
  • 11-31
  • 68-88
  • 114-134
  • 177-193
  • 219-235
  • 278-295
Protein Sequence>Succinate/fumarate mitochondrial transporter MSQKKKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGR TIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGA GITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSL TAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKT RLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYV REHLENLGIFKKNDTPKPKPLK
References
External Links
ResourceLink
Saccharomyces Genome Database SFC1
Uniprot IDP33303
Uniprot NameSFC1_YEAST
GenBank Gene IDAY692924
Genebank Protein ID51013299
General Reference
  • Fernandez, M., Fernandez, E., Rodicio, R. (1994). "ACR1, a gene encoding a protein related to mitochondrial carriers, is essential for acetyl-CoA synthetase activity in Saccharomyces cerevisiae." Mol Gen Genet 242:727-735.7908717
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Palmieri, L., Lasorsa, F. M., De Palma, A., Palmieri, F., Runswick, M. J., Walker, J. E. (1997). "Identification of the yeast ACR1 gene product as a succinate-fumarate transporter essential for growth on ethanol or acetate." FEBS Lett 417:114-118.9395087